SecReT6
Protein ID: 27366866
SecReT6 ID38
T6SS typei5
Gene symbol-
Locus tagVV2_0429
StrainVibrio vulnificus CMCP6
Repliconchromosome II [GenBank: NC_004460] [Browse all T6SS(s) in this replicon]
Location [Strand]462440..462919 [-]
Producthemolysin-coregulated protein
NoteTssD
UniProt IDQ8D6U6
KEGG IDvvu:VV2_0429
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.90E-30, Aligned region: 6..134
Protein Sequence: 159 a.a.     [Download]
>gi|27366866|ref|NP_762393.1| hemolysin-coregulated protein [Vibrio vulnificus CMCP6]
MQSNTYLKYADIKGEATAEQYKDMITLLSVDWSVGREISSYTGTAMDREASSTRLYDMTITKLQDKASPD
LFKEATIGKGKPAVFHITKQGEKIEEIMKIQLTDAMISNYAVSIQDDRPIETITISYTEMMMTVTPTDDK
NNTSAPLVYGYSGVKGQQM
 
Nucleotide Sequence: 480 bp     [Download]
>gi|326424156|ref|NC_004460.2|:c462919-462440 Vibrio vulnificus CMCP6 chromosome II, complete sequence
ATGCAGTCAAATACCTACCTGAAATATGCTGATATTAAAGGTGAAGCTACCGCAGAACAGTACAAGGATA
TGATTACTCTTCTTTCAGTTGATTGGAGTGTAGGTCGTGAAATTTCTTCTTATACTGGTACCGCAATGGA
TCGTGAAGCAAGCTCTACTCGTCTTTACGATATGACCATTACCAAACTTCAAGACAAAGCATCCCCAGAT
CTGTTCAAAGAAGCCACGATTGGTAAGGGTAAACCCGCTGTATTCCATATCACTAAGCAGGGTGAAAAAA
TCGAAGAAATCATGAAAATTCAACTAACGGATGCCATGATTTCTAACTATGCAGTGTCAATTCAAGACGA
CCGTCCAATTGAAACAATCACCATCTCTTACACAGAGATGATGATGACTGTGACGCCTACTGATGACAAA
AACAACACATCTGCTCCGTTGGTATACGGTTACAGCGGTGTTAAAGGTCAACAAATGTAA
 Primer design