SecReT6
Protein ID: 27366868
SecReT6 ID38
T6SS typei5
Gene symbol-
Locus tagVV2_0431
StrainVibrio vulnificus CMCP6
Repliconchromosome II [GenBank: NC_004460] [Browse all T6SS(s) in this replicon]
Location [Strand]465713..466681 [-]
Producthypothetical protein
NoteTssG
UniProt IDQ8D6U4
KEGG IDvvu:VV2_0431
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 4.20E-69, Aligned region: 8..308
Protein Sequence: 322 a.a.     [Download]
>gi|27366868|ref|NP_762395.1| hypothetical protein VV2_0431 [Vibrio vulnificus CMCP6]
MKSEDFLAEIESLPLFTAIHLIETHLLQADSHLGSDALPKNEKIQLTVSQRLGYEARELINVVPNCQSNK
LTLQTNIIGLTGEQGVLPSHYSELVMQRARENDTAMKDFFDIFNHRLLSLYYRCWQSYQLPAQLRTQDKK
SAASPIQTVLSSLTGNLDDEAIFFGGMFTSKRRSRAYIKSIIEFYTGCDVCLHEFKGRWFDISEAEQTRL
CSRDRPEGQHAQLGLGAMLGKQSWNMSSGFDVELIAKDPDSLAALLHTERLSETKHLMCRMLGTSKRIRW
TLTARRAQLPSANLAKGRGRLGKGSILMPSLSNANKQITITI
 
Nucleotide Sequence: 969 bp     [Download]
>gi|326424156|ref|NC_004460.2|:c466681-465713 Vibrio vulnificus CMCP6 chromosome II, complete sequence
ATGAAAAGTGAAGATTTTCTCGCTGAGATTGAATCGCTACCTCTCTTTACCGCGATACATTTGATCGAGA
CTCATCTACTGCAGGCAGATAGTCATCTGGGTTCTGATGCGTTACCAAAGAATGAAAAAATCCAGCTCAC
AGTCTCGCAACGTTTAGGTTATGAGGCGCGAGAGCTGATAAATGTCGTGCCAAATTGCCAGAGCAATAAA
TTAACCTTACAAACCAACATCATCGGTTTAACCGGTGAGCAGGGGGTACTGCCGAGTCATTACAGCGAGC
TGGTTATGCAAAGGGCGCGTGAAAATGACACGGCTATGAAGGATTTCTTCGACATTTTTAACCACAGACT
GCTCTCTCTCTACTACCGGTGTTGGCAGTCATACCAATTGCCCGCACAACTGCGAACGCAAGATAAGAAA
TCAGCGGCGTCGCCCATTCAGACCGTCCTCTCCTCTCTGACTGGCAACCTTGACGATGAAGCGATTTTCT
TTGGCGGTATGTTTACGTCAAAGCGTCGAAGCCGTGCATACATCAAAAGCATCATTGAGTTTTATACCGG
ATGTGATGTGTGTTTGCATGAGTTCAAAGGTCGCTGGTTTGACATTAGTGAAGCAGAGCAAACTCGCCTT
TGCAGCCGTGATAGGCCGGAAGGGCAGCACGCACAACTGGGATTGGGGGCCATGCTTGGTAAGCAAAGCT
GGAACATGAGTTCTGGATTTGATGTCGAGTTGATTGCAAAGGACCCTGATTCATTGGCGGCGTTGCTCCA
CACCGAACGATTGAGTGAGACCAAGCATTTGATGTGCCGCATGTTGGGGACGAGTAAGCGTATTCGTTGG
ACTTTAACCGCTCGTAGAGCACAACTTCCTAGCGCTAACTTAGCAAAAGGAAGAGGTCGATTAGGCAAAG
GCAGTATCTTAATGCCGAGCCTATCGAACGCAAATAAACAAATAACGATAACAATTTAA
 Primer design