SecReT6
Protein ID: 27366869
SecReT6 ID38
T6SS typei5
Gene symbol-
Locus tagVV2_0432
StrainVibrio vulnificus CMCP6
Repliconchromosome II [GenBank: NC_004460] [Browse all T6SS(s) in this replicon]
Location [Strand]466678..468504 [-]
Productprotein ImpG/VasA
NoteTssF
UniProt IDQ8D6U3
KEGG IDvvu:VV2_0432
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.60E-187, Aligned region: 5..608
Protein Sequence: 608 a.a.     [Download]
>gi|27366869|ref|NP_762396.1| protein ImpG/VasA [Vibrio vulnificus CMCP6]
MSEDFLKYYNRELAYLRHKGHEFGEQYPKIAARLRMNDEVVEDPHVSRLLEGCAFLSARIRQSLDNAFPQ
LTEALIGQLFPDFHAPIPSMSIVQLKGTTSSSSAFTVAKGERVTITAPGYQECDFKTCCATQVHPFDVTD
AQFENAPFSGTECRMELAAKSVLKLEIQSNNAELSLSTLDDSCLRFYLSGQRQAALQLYQQIFQSCIGLS
LVQGGRCKKELTPRHIRSLGFDDQIQAVPYSKRSFSGTRLLIEYLHFPEKFLFFELTDLDLSVLASEQGK
VEIWLYFAEGNDWLEKQVSVENIALGAVPVVNLYQAKMKPMRVQASEYEYQLHPEHCDPESSEVVSIDDV
TLRNWNKVFENLPPYYAGTHTHYQTQYDLFWLMRREDRNWAGGFDEPGREVFVSLVDRKHQLFAPDAKES
WLMSIDTWCCNRNLPAKIPFGGGLPLVTLPESQDNFSRVRCLTTPTETIRAEMDETTRWQFAKLITLDHF
CNQQGAETLKQILNLLAFRGSPETKALIDSIKGMSTKMTTGRVVQNGRVGFCHGSEITLTISDQILSREQ
IFLLGNVLSSYFSQFAEVNTFTRLLIKLSSTGALFHTWPSMAGERELL
 
Nucleotide Sequence: 1827 bp     [Download]
>gi|326424156|ref|NC_004460.2|:c468504-466678 Vibrio vulnificus CMCP6 chromosome II, complete sequence
ATGAGTGAAGATTTTCTGAAATACTACAATCGAGAACTCGCGTATTTGCGTCATAAAGGCCATGAATTTG
GGGAACAATACCCTAAGATTGCAGCTCGATTGCGAATGAATGATGAAGTCGTTGAAGACCCTCATGTCTC
AAGGCTTCTCGAAGGGTGTGCTTTTCTCTCTGCTCGTATACGACAAAGCTTGGATAACGCGTTTCCACAG
CTAACCGAAGCGTTAATTGGGCAGCTATTTCCCGATTTTCATGCCCCCATTCCGTCAATGTCGATTGTGC
AGTTGAAAGGAACGACCTCTTCGTCGTCGGCGTTTACGGTGGCCAAAGGAGAACGCGTCACGATCACGGC
ACCGGGATACCAAGAGTGTGACTTCAAAACATGCTGTGCCACACAAGTTCATCCTTTTGATGTCACTGAC
GCCCAGTTTGAAAATGCCCCTTTTAGCGGCACAGAATGTCGTATGGAGCTCGCTGCCAAGTCAGTGCTCA
AACTCGAAATTCAATCGAACAATGCTGAGTTGAGCCTATCCACTCTGGATGATTCATGCCTGCGATTCTA
TCTGAGTGGTCAACGACAAGCGGCTCTGCAGCTTTATCAACAAATTTTTCAATCCTGCATTGGCCTAAGC
TTGGTACAAGGAGGTCGATGCAAAAAAGAGCTCACGCCACGTCACATACGTTCATTGGGCTTCGACGACC
AAATACAGGCGGTTCCATACAGTAAGCGTAGCTTTTCTGGCACGCGTCTATTGATCGAGTACTTGCACTT
CCCCGAAAAATTTCTCTTTTTTGAGCTGACAGACTTAGATCTCTCAGTCCTCGCTAGCGAACAAGGGAAA
GTGGAAATCTGGCTCTATTTTGCAGAGGGCAACGACTGGTTGGAGAAACAAGTCTCTGTCGAAAATATCG
CCTTAGGAGCGGTTCCGGTTGTCAATCTTTATCAAGCGAAAATGAAGCCAATGAGGGTGCAAGCCTCTGA
ATATGAATATCAACTGCATCCAGAGCACTGCGATCCAGAGTCGAGTGAAGTGGTCAGTATTGATGACGTC
ACTTTAAGAAACTGGAATAAGGTCTTCGAAAACTTGCCCCCTTACTATGCGGGGACGCATACCCACTATC
AAACGCAATATGATCTGTTCTGGTTAATGCGTAGAGAAGATAGAAACTGGGCTGGTGGTTTTGATGAACC
CGGGCGGGAAGTGTTCGTATCACTGGTTGATCGTAAGCACCAATTGTTTGCCCCCGATGCGAAAGAAAGT
TGGTTGATGTCGATCGACACGTGGTGTTGCAATCGTAATCTCCCCGCCAAAATTCCGTTTGGTGGAGGGC
TTCCTTTGGTCACATTGCCCGAGAGTCAGGACAATTTTAGTCGCGTTCGTTGCTTGACCACGCCAACCGA
AACCATTCGCGCCGAAATGGATGAGACGACTCGATGGCAGTTTGCAAAACTGATTACATTGGATCATTTC
TGCAATCAACAAGGAGCGGAAACGCTTAAGCAAATCTTAAACTTGCTGGCTTTTAGAGGTTCGCCAGAAA
CCAAAGCATTGATCGATTCAATTAAAGGTATGTCGACAAAGATGACGACTGGGCGTGTGGTGCAAAATGG
TCGGGTCGGTTTTTGCCACGGCAGCGAAATCACCTTAACGATTTCCGATCAGATTTTGTCTCGAGAACAG
ATCTTTTTGTTAGGAAACGTGCTATCGAGTTACTTCTCACAATTCGCTGAAGTCAACACGTTCACACGGC
TACTGATTAAGCTCTCCTCCACTGGGGCGTTATTCCATACATGGCCATCGATGGCGGGAGAGAGAGAGCT
GTTATGA
 Primer design