SecReT6
Protein ID: 27366870
SecReT6 ID38
T6SS typei5
Gene symbol-
Locus tagVV2_0433
StrainVibrio vulnificus CMCP6
Repliconchromosome II [GenBank: NC_004460] [Browse all T6SS(s) in this replicon]
Location [Strand]468501..468974 [-]
Producthypothetical protein
NoteTssE
UniProt IDQ8D6U2
KEGG IDvvu:VV2_0433
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 6.40E-21, Aligned region: 30..137
Protein Sequence: 157 a.a.     [Download]
>gi|27366870|ref|NP_762397.1| hypothetical protein VV2_0433 [Vibrio vulnificus CMCP6]
MSETGLVPSLMDKLTDSDPLSSIDRDFPLTRHALMDSLRRDLESLLNSRINWMTLSDELREIQTSILRYG
LPDFSSMPFSSADGQQVLCQRVKETIQQYEPRLNYVSVAIAEDKNPLDRILKLRIKATCMIDNNEQELVM
DSEVEPVSLGIKLSRAK
 
Nucleotide Sequence: 474 bp     [Download]
>gi|326424156|ref|NC_004460.2|:c468974-468501 Vibrio vulnificus CMCP6 chromosome II, complete sequence
ATGAGTGAAACAGGTCTAGTCCCATCCCTCATGGATAAATTGACGGACAGTGATCCTCTGAGCAGCATTG
ATAGAGACTTTCCATTAACGCGACATGCGTTGATGGATTCACTCAGACGAGATCTTGAATCATTACTGAA
CAGCCGTATCAACTGGATGACGTTGTCAGATGAGCTACGTGAAATACAGACGTCTATCTTGCGATATGGT
TTGCCAGATTTCTCATCAATGCCATTTAGCAGCGCGGATGGGCAACAGGTTCTGTGCCAACGAGTGAAAG
AAACCATTCAACAGTATGAACCTAGGCTCAACTATGTGTCGGTCGCCATTGCAGAAGACAAAAATCCGTT
AGATCGAATTTTAAAACTCAGAATCAAGGCGACCTGCATGATTGATAATAACGAGCAGGAGTTGGTTATG
GATTCGGAAGTTGAGCCCGTCAGTCTAGGGATAAAACTGAGTAGAGCGAAATGA
 Primer design