SecReT6
Protein ID: 27366871
SecReT6 ID38
T6SS typei5
Gene symbol-
Locus tagVV2_0434
StrainVibrio vulnificus CMCP6
Repliconchromosome II [GenBank: NC_004460] [Browse all T6SS(s) in this replicon]
Location [Strand]468971..469774 [-]
Productprotein of avirulence locus ImpE
NoteTagJ
UniProt IDQ8D6U1
KEGG IDvvu:VV2_0434
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 6.00E-38, Aligned region: 138..259
Protein Sequence: 267 a.a.     [Download]
>gi|27366871|ref|NP_762398.1| protein of avirulence locus ImpE [Vibrio vulnificus CMCP6]
MSDWQDHLSRSELELAKQALIKEIKLAPKNATIRSKFIELLCIMGEFERADEQLMQSIKLFPEYLPGASQ
IRHLVKAAQARKDFFAGAASAQFIEGTEKLGETIVQFILAQKENNHEELISVCERAEQSRQALQFEINGV
RYDDVRDLDDRLGGFIELFSSAGNYFLVPMDHLHYLELKPATNMLETLWRPCEFDIQGLGEGEAHFPMTY
VDSESGNQKLGRETDWKNVLGTDHCIGQGQKMWLVGDNALALSQLERVALAVETTIE
 
Nucleotide Sequence: 804 bp     [Download]
>gi|326424156|ref|NC_004460.2|:c469774-468971 Vibrio vulnificus CMCP6 chromosome II, complete sequence
ATGTCAGATTGGCAAGACCACCTCAGTCGAAGCGAGCTCGAACTCGCCAAACAAGCGCTGATTAAAGAAA
TCAAATTGGCGCCCAAAAACGCCACTATTCGCAGCAAGTTTATTGAACTGCTATGCATCATGGGCGAGTT
TGAGCGCGCGGATGAACAGTTAATGCAGTCCATTAAGTTGTTCCCTGAGTATTTGCCCGGAGCAAGCCAA
ATTCGTCATCTGGTTAAAGCTGCTCAAGCAAGAAAGGACTTTTTTGCAGGCGCCGCATCAGCGCAATTCA
TAGAGGGTACCGAAAAACTGGGTGAAACGATTGTTCAGTTCATTTTGGCGCAAAAAGAGAACAACCATGA
GGAACTGATCTCGGTGTGTGAGCGTGCAGAGCAATCCCGTCAAGCACTCCAATTTGAAATTAATGGTGTG
CGCTATGATGATGTGAGAGATCTCGATGATCGATTGGGGGGCTTCATTGAGCTCTTTTCTTCCGCAGGTA
ACTATTTCTTAGTTCCGATGGACCATCTCCATTACTTGGAACTCAAACCCGCCACCAACATGTTGGAAAC
ACTATGGCGACCATGCGAGTTCGATATTCAAGGACTTGGCGAAGGTGAAGCTCATTTCCCAATGACGTAC
GTAGATTCCGAAAGTGGCAACCAAAAACTGGGCAGAGAAACGGACTGGAAAAATGTTCTAGGTACGGATC
ACTGCATCGGTCAAGGGCAAAAGATGTGGCTGGTTGGTGACAATGCGCTGGCTTTGAGCCAATTAGAACG
AGTCGCCTTGGCTGTGGAAACCACGATTGAATGA
 Primer design