SecReT6
Protein ID: 27366872
SecReT6 ID38
T6SS typei5
Gene symbol-
Locus tagVV2_0435
StrainVibrio vulnificus CMCP6
Repliconchromosome II [GenBank: NC_004460] [Browse all T6SS(s) in this replicon]
Location [Strand]469785..471278 [-]
Producthypothetical protein
NoteTssC
UniProt IDQ8D6U0
KEGG IDvvu:VV2_0435
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.70E-164, Aligned region: 60..491
Protein Sequence: 497 a.a.     [Download]
>gi|27366872|ref|NP_762399.1| hypothetical protein VV2_0435 [Vibrio vulnificus CMCP6]
MNFIEIEQLSHDLPTPESALENGIWMAHFLDAKTMTQMVSYWVEISGAKTKQEFVHSIISAIESIDREVS
AQLDEILHHRQMQKLEATWRGLNYLVQQKDHNAGELVKVKVLSCTWEELKKDSERAIEFDQSALFKLVYQ
NEYSMPGGEPFGLLIGDYYLCGGQNAMVVEREINILRKIAQSAAAAFSPFIMSVEPSVFGSDYFENIASM
TNVYAQFEQNEYVSWKRLRAEEDVRFIGLTLPNLLYRQPYQSDGSRSDSFVYNERVRDSHQDLLWGNAAY
SFAAVIVRAFQEHGWFTHIRGHKTGDYSQGIIQPPSLCQVDLPGKGGRYRAPLNLKITEKREQELADCGF
IPLSPVAETPFVSFTSNISLHKPQQFASKGASVNARLSSMLQYTLCVSRIAHYLKVMGRDRIGSYQDAQS
IERDFQAWLHKYTTASDEASDELRAKYPLNEAKIKVTEKLGSPGKYYSVIHLRPHFQLDQMVSSIKLITE
LSPEHIV
 
Nucleotide Sequence: 1494 bp     [Download]
>gi|326424156|ref|NC_004460.2|:c471278-469785 Vibrio vulnificus CMCP6 chromosome II, complete sequence
ATGAATTTCATCGAAATTGAGCAACTTTCCCACGATTTACCGACACCAGAGTCTGCTTTGGAGAATGGTA
TTTGGATGGCGCATTTTCTTGATGCCAAGACGATGACGCAGATGGTGAGCTATTGGGTTGAGATTTCTGG
AGCGAAAACGAAACAAGAGTTTGTTCACAGCATCATCAGTGCCATTGAATCGATTGATAGGGAAGTGAGC
GCTCAACTGGATGAGATTCTTCATCACCGACAAATGCAAAAGCTTGAAGCGACGTGGCGAGGCTTAAATT
ACCTTGTGCAGCAGAAAGATCACAATGCCGGAGAGCTTGTAAAGGTCAAAGTCCTATCTTGTACATGGGA
AGAGCTGAAGAAAGACAGTGAGCGAGCGATAGAGTTCGATCAATCCGCGCTGTTTAAGTTGGTCTATCAA
AACGAATACTCGATGCCAGGGGGAGAGCCGTTTGGTTTATTGATTGGCGACTATTATCTCTGTGGCGGTC
AAAACGCCATGGTGGTTGAAAGAGAAATCAACATATTAAGGAAAATTGCGCAGTCGGCAGCAGCGGCGTT
TAGCCCTTTCATTATGTCGGTCGAACCGAGTGTTTTTGGTTCAGATTACTTTGAAAACATCGCGTCGATG
ACGAACGTCTATGCCCAATTTGAGCAAAATGAATACGTGAGTTGGAAACGACTACGAGCCGAAGAAGATG
TTCGGTTTATTGGTTTAACGCTACCCAACCTTTTGTATCGTCAGCCATATCAAAGTGACGGCTCGAGATC
GGATTCGTTTGTTTATAACGAACGAGTTCGAGATTCGCACCAAGATTTGTTGTGGGGAAATGCCGCCTAT
TCCTTTGCCGCGGTCATTGTTAGAGCATTTCAAGAGCATGGTTGGTTTACACACATACGTGGACATAAAA
CAGGGGACTACTCTCAAGGCATTATCCAGCCTCCTTCTTTATGTCAGGTTGATTTACCAGGAAAGGGAGG
GCGATATCGCGCACCTCTCAACTTAAAAATAACGGAAAAAAGAGAGCAAGAGTTGGCAGATTGTGGATTT
ATCCCTCTGTCTCCCGTCGCTGAAACGCCGTTTGTTAGCTTTACGTCGAACATCTCTTTGCACAAACCTC
AGCAGTTTGCTTCCAAGGGAGCGAGTGTAAATGCACGTTTGTCTTCGATGTTGCAATACACCTTATGTGT
TTCAAGAATTGCTCACTATTTAAAAGTGATGGGAAGAGATCGGATTGGCAGCTATCAAGATGCCCAATCG
ATAGAACGAGATTTTCAGGCGTGGCTTCATAAATATACCACTGCGTCTGATGAGGCTTCGGATGAACTGA
GAGCAAAATATCCGCTTAACGAAGCCAAAATAAAAGTCACTGAAAAGCTAGGTAGCCCAGGAAAATATTA
TTCGGTGATCCACCTACGGCCCCATTTTCAACTGGATCAAATGGTTTCATCGATCAAGTTGATTACGGAG
TTGTCTCCTGAGCATATTGTATAA
 Primer design

Protein ID: 27366873
SecReT6 ID38
T6SS typei5
Gene symbol-
Locus tagVV2_0436
StrainVibrio vulnificus CMCP6
Repliconchromosome II [GenBank: NC_004460] [Browse all T6SS(s) in this replicon]
Location [Strand]471323..472816 [-]
Producthypothetical protein
NoteTssC
UniProt IDQ8D6T9
KEGG IDvvu:VV2_0436
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.00E-188, Aligned region: 63..493
Protein Sequence: 497 a.a.     [Download]
>gi|27366873|ref|NP_762400.1| hypothetical protein VV2_0436 [Vibrio vulnificus CMCP6]
MTTQLETQLDPTVEGQSFSFLEQAIGATKQTEASRAEELIKTLTEEALKGTVTWNKNLTVTFREAITALD
KKISEQLSAVMHHPELQKLEGTWRGLNYLVMNSETSSTLKIRMVSMTKKELHKDLSKAVEFDQSQVFKKV
YESEFGSAGGEPYGAIIGDYEFTNHPEDIETLRLMSNVAAAGFSPFLSAASPALFGFDEWTELSKPRDLE
KVFESLEYTQWRAFRESQDSRFVSLTMPKVLARLPYGQATSPVEEFGFEEFSVDETTGIAVNAQHNDYCW
MNSSYVLGAKLTDAFAKYGFCTAIRGAEGGGRVDNLPTHFFMSDDGDPDMKCPTEIGITDRRESELGKLG
FLPLCHYKNTNYAVFFGAQTCQKPAKYDSPDATANAAISARLPYMMATSRFAHYLKVMARDKIGSFMEAE
DVESWLNRWILGYVNASEGGGQEIRAKYPLADARVQVREVPGAPGAYNAVAWLKPWLQMEELTTSLRLVA
KIPQSGG
 
Nucleotide Sequence: 1494 bp     [Download]
>gi|326424156|ref|NC_004460.2|:c472816-471323 Vibrio vulnificus CMCP6 chromosome II, complete sequence
ATGACAACACAGCTTGAAACACAATTAGACCCCACCGTTGAAGGCCAGAGTTTTTCCTTCTTAGAACAAG
CGATTGGCGCGACCAAACAAACGGAAGCGTCGAGAGCAGAAGAGTTAATCAAAACATTAACAGAAGAAGC
TTTAAAAGGTACGGTAACGTGGAATAAAAACCTAACCGTGACGTTTCGTGAAGCCATTACCGCTTTGGAC
AAAAAGATTTCCGAACAGCTGTCTGCGGTGATGCATCACCCTGAGTTGCAAAAGTTGGAAGGAACGTGGC
GTGGGTTGAATTATCTGGTGATGAATTCGGAAACGAGCTCCACGTTAAAGATTCGTATGGTGAGTATGAC
CAAGAAAGAGCTGCACAAAGATTTGAGTAAAGCAGTGGAGTTCGATCAAAGCCAGGTCTTTAAGAAAGTC
TACGAATCAGAATTCGGTAGTGCTGGTGGTGAGCCATATGGTGCGATCATTGGTGACTATGAATTTACGA
ATCATCCAGAAGATATTGAAACGCTGCGTCTTATGTCGAATGTTGCGGCAGCTGGTTTTTCTCCATTCCT
TTCTGCCGCCTCACCTGCGTTGTTTGGTTTTGACGAATGGACGGAATTGTCGAAGCCTAGAGATTTAGAG
AAAGTATTTGAGTCGCTCGAGTACACTCAGTGGCGCGCATTCCGTGAAAGCCAAGACTCACGCTTTGTCA
GCTTGACGATGCCGAAAGTCCTTGCTCGACTTCCTTATGGACAAGCGACATCGCCAGTCGAAGAGTTTGG
TTTTGAAGAGTTTTCCGTAGACGAAACCACCGGAATTGCCGTGAATGCGCAGCACAACGACTACTGCTGG
ATGAACTCGTCGTATGTACTGGGAGCGAAGCTCACTGACGCATTTGCCAAGTATGGATTCTGCACGGCAA
TTCGTGGTGCTGAGGGTGGTGGTCGTGTCGACAATCTGCCAACGCACTTCTTTATGAGTGACGATGGCGA
TCCAGATATGAAATGCCCGACCGAAATTGGCATTACTGACCGTCGTGAATCCGAGTTAGGTAAACTGGGC
TTCCTGCCTTTATGTCACTATAAGAATACCAACTACGCTGTATTCTTTGGTGCGCAAACCTGCCAAAAAC
CAGCCAAATACGATTCGCCAGATGCCACTGCGAATGCTGCGATTTCTGCGCGCTTGCCTTACATGATGGC
GACTTCTCGTTTTGCGCATTATCTCAAGGTCATGGCGCGAGATAAGATTGGTAGCTTCATGGAAGCAGAA
GACGTTGAGTCATGGCTAAATCGATGGATCCTTGGCTACGTCAACGCGTCGGAAGGCGGTGGTCAAGAGA
TCCGTGCGAAATACCCGTTGGCGGATGCGCGAGTGCAGGTCAGAGAAGTTCCTGGCGCACCGGGTGCTTA
CAACGCGGTCGCGTGGCTTAAGCCTTGGCTGCAAATGGAAGAGCTCACAACGTCTCTCCGTTTGGTAGCG
AAAATCCCTCAGTCTGGCGGATAA
 Primer design