SecReT6
Protein ID: 27366874
SecReT6 ID38
T6SS typei5
Gene symbol-
Locus tagVV2_0437
StrainVibrio vulnificus CMCP6
Repliconchromosome II [GenBank: NC_004460] [Browse all T6SS(s) in this replicon]
Location [Strand]472828..473340 [-]
Producthypothetical protein
NoteTssB
UniProt IDQ8D6T8
KEGG IDvvu:VV2_0437
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.00E-61, Aligned region: 8..162
Protein Sequence: 170 a.a.     [Download]
>gi|27366874|ref|NP_762401.1| hypothetical protein VV2_0437 [Vibrio vulnificus CMCP6]
MTSIHSKLSRVRKPRVHITYDVETEGTSLKKELPFVVGVMGDFAGQNTEALKPLKDRRFIQIDRDNFDDV
LKKMSPSVEFKVKNTMVDDGTEFAVNLQFQSMKDFEPASIVRQVDPLRQLMDTRNKLRDLMTKVDRSEEL
ENVLEAVLNNTDNLSKLADELKLGQEEKAE
 
Nucleotide Sequence: 513 bp     [Download]
>gi|326424156|ref|NC_004460.2|:c473340-472828 Vibrio vulnificus CMCP6 chromosome II, complete sequence
ATGACTAGTATCCACTCGAAATTATCGCGAGTACGGAAGCCACGTGTTCATATTACCTATGATGTTGAAA
CAGAAGGCACATCACTGAAGAAAGAACTTCCGTTTGTAGTGGGTGTGATGGGGGATTTTGCTGGCCAAAA
TACTGAAGCCCTCAAACCACTAAAAGACCGTCGCTTTATTCAAATTGATCGAGACAACTTTGATGATGTA
CTCAAGAAAATGAGTCCATCAGTGGAGTTTAAAGTGAAAAACACGATGGTGGATGACGGAACGGAATTTG
CGGTCAATCTGCAGTTCCAATCGATGAAGGATTTCGAACCCGCCTCGATTGTTAGACAAGTTGATCCGCT
TCGTCAATTAATGGACACACGCAACAAATTGCGTGACCTAATGACCAAAGTTGACCGTTCAGAAGAACTA
GAAAACGTGCTTGAAGCGGTTTTGAACAACACCGACAACCTATCTAAATTGGCTGATGAACTCAAGTTAG
GCCAAGAAGAGAAAGCGGAGTAA
 Primer design