SecReT6
Protein ID: 27366875
SecReT6 ID38
T6SS typei5
Gene symbol-
Locus tagVV2_0438
StrainVibrio vulnificus CMCP6
Repliconchromosome II [GenBank: NC_004460] [Browse all T6SS(s) in this replicon]
Location [Strand]473357..474490 [-]
Producthypothetical protein
NoteTssA
UniProt IDQ8D6T7
KEGG IDvvu:VV2_0438
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.00E-20, Aligned region: 69..129
Protein Sequence: 377 a.a.     [Download]
>gi|27366875|ref|NP_762402.1| hypothetical protein VV2_0438 [Vibrio vulnificus CMCP6]
MSHHYEEFTWFEPALLPISAEQPAGVDPRSDITPQSLYYRLKDQRMQARNIERNAIIEEEPILNYANLWQ
VFLDEVPQALTSQTKDLEYVAWLIEALTRLDGFKGMAVGYELATYYLENYWADLYPMPDEDGLETRISPI
IGLNGIDNEGTLIFPLSCIPMTEGLLEQPYAYWEYQQALDLERCDEDKKRAKRDQGVPELSDITQAVKSS
SSQFYQRLIEDLNRAISSFERFSQALDSACEEVTPSSYISRKLDAIHSAIMHLASDKMIKVSKETNSDEP
SHSASSHEGEIDGRGQGEANFQLLAANMHSREQAIVHLQRVADFFRETEPHSPVSYTIEQVIRWCGMSLP
ELLAELISDGDAKKGYFRLVGIADKNE
 
Nucleotide Sequence: 1134 bp     [Download]
>gi|326424156|ref|NC_004460.2|:c474490-473357 Vibrio vulnificus CMCP6 chromosome II, complete sequence
ATGAGTCATCACTATGAGGAGTTCACTTGGTTTGAGCCGGCCTTACTGCCAATTTCTGCCGAGCAGCCAG
CAGGTGTGGATCCAAGAAGTGATATTACGCCTCAGTCACTCTATTACCGACTGAAAGACCAGAGAATGCA
GGCGAGAAATATTGAGCGAAATGCCATTATTGAAGAAGAGCCTATTCTTAACTATGCCAACCTCTGGCAA
GTGTTTCTTGATGAAGTTCCGCAGGCACTGACGTCACAAACCAAAGATCTCGAGTACGTGGCATGGCTTA
TCGAAGCGTTAACTCGCCTTGATGGTTTTAAAGGAATGGCGGTTGGCTATGAGCTGGCCACCTACTACTT
AGAAAATTATTGGGCAGATCTGTATCCAATGCCGGATGAAGATGGCCTAGAAACAAGAATTTCGCCCATC
ATCGGCCTGAATGGCATCGATAATGAGGGGACGCTCATTTTTCCGTTATCGTGCATACCCATGACCGAAG
GGCTGTTAGAACAACCTTATGCGTATTGGGAGTATCAACAAGCTTTGGACTTGGAGCGCTGTGATGAGGA
CAAGAAACGAGCCAAACGCGATCAGGGTGTCCCTGAGTTATCTGACATTACCCAAGCCGTCAAATCGTCG
AGCAGTCAGTTCTACCAAAGACTGATAGAGGATCTAAATAGAGCGATAAGTTCTTTTGAACGATTTTCAC
AGGCTTTGGATAGTGCGTGTGAAGAAGTCACCCCAAGTTCCTACATTTCTCGAAAATTAGATGCAATACA
CTCGGCAATTATGCATTTGGCGAGTGACAAAATGATCAAGGTTTCAAAAGAAACGAATTCAGATGAACCA
TCGCACTCTGCTTCTAGTCACGAAGGCGAGATCGATGGACGAGGGCAGGGCGAAGCTAATTTTCAGTTAT
TGGCCGCAAATATGCACTCTCGTGAACAGGCCATAGTGCATTTGCAACGAGTGGCTGATTTTTTTCGTGA
AACAGAACCGCATTCACCCGTTTCATACACGATTGAACAAGTGATTCGATGGTGTGGAATGTCTTTGCCA
GAACTCCTGGCAGAGCTTATTTCCGATGGAGACGCCAAGAAAGGCTATTTCCGTTTGGTTGGCATAGCAG
ACAAAAATGAGTAA
 Primer design