SecReT6
Protein ID: 27366879
SecReT6 ID38
T6SS typei5
Gene symbol-
Locus tagVV2_0442
StrainVibrio vulnificus CMCP6
Repliconchromosome II [GenBank: NC_004460] [Browse all T6SS(s) in this replicon]
Location [Strand]479474..480802 [-]
Productflagellar motor protein
NoteTssL
UniProt IDQ8D6T3
KEGG IDvvu:VV2_0442
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.60E-62, Aligned region: 50..255
OmpA [PF00691], Evalue: 4.90E-14, Aligned region: 77..99
OmpA [PF00691], Evalue: 4.90E-14, Aligned region: 323..421
Spore_YhaL [PF14147], Evalue: 0.004, Aligned region: 232..259
Protein Sequence: 442 a.a.     [Download]
>gi|27366879|ref|NP_762406.1| flagellar motor protein [Vibrio vulnificus CMCP6]
MDETIVKPTPGRKKAPQSTPVASLESDNTVLFTQNSKETRETSIVAFGNNVLLAEANVIVSLLGQIRATA
THSDVKQLREAFVQKMRDYENRLRLQGANSKQIDIARYCLCCAIDEAVLNTEWGSQSVWGHNSLLSTFYS
NTQGGEQFFIHLDESLAEPNKHLDLLEVMYICMSLGFLGQFRVRENGIEQHRSLKNRVMDVLKSHGRDYS
PSLNDDALAKVLVGEQIAEKAPLWVVLSITAAVLVSVYMYLSYSLNEKSDQTFSQLMNLVPSKEIENQSA
DYISSLAVANQIQRSLATEIEMVLLKVDALPDRVRITFQSNDLFESGSAELVAHIFPVVSKVARALEATN
GKILVVGHTDNNPIFTSKFPSNWHLSLARATALTDRLASAGKLSGRVIPEGMGDARPLVSNETAEGRSIN
RRVEIDLLVQTQSKMDANNGKD
 
Nucleotide Sequence: 1329 bp     [Download]
>gi|326424156|ref|NC_004460.2|:c480802-479474 Vibrio vulnificus CMCP6 chromosome II, complete sequence
ATGGACGAAACGATTGTAAAACCAACCCCTGGGCGTAAAAAAGCACCGCAGTCGACACCTGTTGCATCGC
TTGAAAGCGATAACACGGTTCTCTTTACGCAAAATAGTAAAGAAACGCGTGAAACGAGTATCGTCGCGTT
TGGCAATAACGTACTGCTGGCAGAAGCGAATGTCATTGTTTCCTTGCTTGGCCAAATTAGAGCGACGGCC
ACGCACAGTGATGTCAAACAGTTACGTGAAGCATTTGTGCAAAAAATGCGTGACTATGAAAACCGGTTGA
GATTACAAGGCGCAAATAGTAAGCAGATCGATATCGCACGCTACTGTTTATGTTGTGCTATCGATGAAGC
CGTCCTAAATACCGAATGGGGAAGTCAATCCGTTTGGGGACACAACTCGTTATTGTCGACATTCTATTCC
AACACTCAAGGCGGTGAGCAGTTCTTCATACATCTCGATGAAAGTCTTGCCGAACCCAATAAGCACTTAG
ATCTGCTAGAAGTCATGTATATCTGCATGAGCTTAGGTTTTTTGGGGCAATTTCGAGTTCGAGAAAATGG
AATCGAGCAACATCGTTCCTTAAAAAACCGCGTAATGGATGTCCTTAAATCGCACGGTCGGGACTACAGT
CCTTCACTCAACGATGATGCGTTAGCCAAAGTATTGGTTGGTGAGCAGATCGCAGAAAAAGCACCATTGT
GGGTTGTTTTATCAATTACCGCGGCTGTGTTAGTCAGTGTGTACATGTACTTAAGTTATAGCCTAAACGA
AAAATCCGATCAGACCTTTAGTCAGTTAATGAACTTAGTGCCGAGCAAAGAGATAGAGAACCAGAGTGCG
GATTATATTTCGTCTCTTGCCGTAGCAAATCAAATCCAACGTTCGTTGGCAACGGAAATAGAAATGGTTT
TACTAAAAGTCGATGCATTACCCGATAGAGTGCGTATTACTTTTCAGTCCAATGATCTGTTTGAATCGGG
CAGTGCGGAGCTTGTCGCGCATATATTCCCTGTGGTTTCGAAAGTGGCCAGAGCACTCGAGGCGACCAAT
GGAAAAATATTGGTTGTCGGACATACCGATAATAACCCCATTTTTACCAGTAAATTCCCTTCTAACTGGC
ATTTATCTCTCGCCAGAGCGACAGCGCTTACCGATCGCTTAGCATCAGCAGGCAAATTGAGTGGGCGCGT
CATTCCTGAAGGAATGGGAGATGCGAGACCTTTGGTATCAAATGAAACCGCAGAAGGAAGAAGTATCAAC
CGTAGAGTCGAAATCGATCTCCTAGTTCAAACCCAATCAAAAATGGATGCAAACAATGGCAAAGATTAA
 Primer design