SecReT6
Protein ID: 27366881
SecReT6 ID38
T6SS typei5
Gene symbol-
Locus tagVV2_0444
StrainVibrio vulnificus CMCP6
Repliconchromosome II [GenBank: NC_004460] [Browse all T6SS(s) in this replicon]
Location [Strand]482157..482612 [-]
ProductType VI secretion lipoprotein/VasD
NoteTssJ
UniProt IDQ8D6T1
KEGG IDvvu:VV2_0444
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 5.70E-37, Aligned region: 14..147
Protein Sequence: 151 a.a.     [Download]
>gi|27366881|ref|NP_762408.1| Type VI secretion lipoprotein/VasD [Vibrio vulnificus CMCP6]
MKAMAKIITTIIVFLLVGCSAANMVVSPYSNLEIKTGFNVNPDMNGRPSPVVVYVLELTSDTLFTSQDFF
SLYENTAQTLGPDLVNKTELYLSPGQKTLYESTMKPSVEYIGIVVAYRDIENANWRKVIKVDRKGYNTYE
LSLDELSLAIK
 
Nucleotide Sequence: 456 bp     [Download]
>gi|326424156|ref|NC_004460.2|:c482612-482157 Vibrio vulnificus CMCP6 chromosome II, complete sequence
ATGAAAGCCATGGCAAAAATAATTACCACAATAATAGTGTTTTTATTAGTGGGTTGCAGTGCGGCAAATA
TGGTTGTTTCTCCCTATTCAAATTTGGAAATAAAGACGGGATTCAATGTCAATCCAGATATGAATGGCAG
ACCTTCACCTGTCGTAGTTTATGTCCTTGAACTCACTTCTGATACCTTATTTACGAGTCAAGACTTCTTC
TCTCTATATGAAAATACAGCCCAAACGCTAGGCCCGGATCTGGTGAACAAAACAGAATTGTATCTCTCCC
CAGGCCAAAAAACACTTTATGAATCTACGATGAAACCAAGTGTTGAATATATCGGCATTGTAGTGGCATA
TCGAGACATCGAAAATGCAAATTGGCGCAAGGTGATAAAGGTCGACCGCAAGGGCTATAACACCTACGAG
CTTTCACTAGATGAATTGTCTTTGGCTATAAAATAA
 Primer design