SecReT6
Protein ID: 27378712
SecReT6 ID39
T6SS typei3
Gene symbol-
Locus tagblr3601
StrainBradyrhizobium japonicum USDA 110
Repliconchromosome [GenBank: NC_004463] [Browse all T6SS(s) in this replicon]
Location [Strand]3979809..3983345 [+]
Producthypothetical protein
NoteTssM
UniProt IDQ89P82
KEGG IDbja:blr3601
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 9.80E-86, Aligned region: 181..438
IcmF-related [PF06761], Evalue: 4.50E-84, Aligned region: 494..804
IcmF-related [PF06761], Evalue: 4.50E-84, Aligned region: 882..918
DUF1215 [PF06744], Evalue: 2.00E-35, Aligned region: 697..739
DUF1215 [PF06744], Evalue: 2.00E-35, Aligned region: 897..1021
AAA_25 [PF13481], Evalue: 0.00041, Aligned region: 116..134
AAA_25 [PF13481], Evalue: 0.00041, Aligned region: 168..198
AAA_25 [PF13481], Evalue: 0.00041, Aligned region: 397..422
AAA_19 [PF13245], Evalue: 0.0017, Aligned region: 118..134
AAA_19 [PF13245], Evalue: 0.0017, Aligned region: 398..429
Protein Sequence: 1178 a.a.     [Download]
>gi|27378712|ref|NP_770241.1| unnamed protein product [Bradyrhizobium japonicum USDA 110]
MLAKDVLRIVLYGVGLSSLGAVIYFAGPFIAFGDWRPLENHIVRQIAILLLTTIVAGIVGLNLFKRRKGA
KEIADGIAGADQPVSDEPVLKERMKDALATLKTASGNKSGFLYDLPWYVIIGPPGAGKTTALVNSGLKFP
LARGATPAAIAGVGGTRYCDWWFTEEAVLIDTAGRYTTQDSNSKADKDSWLAFLDILKKSRSRQPINGVL
VAISIEDILTLPKQELALHADAIRMRLLELHQRLKVSFPVYALFTKADLVAGFTEYFAYLGDAGRRQVWG
ATFQTADKTQNLVGQIPVEFDRLLERLSEETLDRLQDEPTPQHRVQLFGFPAQMARLKPQIHDFLNLIFE
PTRYHVNANLRGFYFTSGTQQGTPIDQLIGSLARTFGAEEVGSGSYSGTGKSFFLADLISKVIIGEADWV
STDRAAVRRALILKTAALSLIGLVSIGLIAAWLTSYKRNSDLIEQSLQADSEYAAAGAPIIKQTLIADHD
LDKVLPLLYRLRNAPAGYGSRGESVPLSARYGLSQHARLLSPSKAAYHTALERMFRPRLLYRLEEQLNAR
INEPAFVYEALKVYLMVGGLQSPDRELIRSWMQRDWADNLYPGATNAEGRRLLDENLVAMFDLETEQQPL
VELDGRLIKQAQSSLARLSVSQRAYEFLKSEARASTAGDWIASRHGGPDMGVVFETTTGQPLDAVRVPEF
FTYNGFHQKFVARLSGLSERMKRERWVLGDAGQQSAIDQQYDNLAGDLLSIYSNDFVTTWRTALGSLRLK
KLLADKPKYEVLRALSAPTSPMRQILESVRDETVLTKERAKPASASAAAAAPAPALFTNAQDGPPGAMIE
AQFKPYHAALEGESTRRPIDSTVANLNDIAQNLTLIIENPQLTAQATAALQTQVAALRNNASRMPPPFSD
MLRAAAAEFEGSIAASTAGQILQTLRDQVTPVCQQTVTNRYPFIRSSSQEVPLADFAKLFSPNGVMDKFF
TQYLAPYADTSRSDWVWRKESPVGRSFSPDTLKQFQNAAYIRDAFFQTGGGLPAVSFAIRPPGAAGPGVT
VKTEIGGTTITSPTTPGPATSSLFGGPQPTPPPPPQSNSPTTVLWPGPAPRTAISVSNDTGPPSVLERIG
PWSLFRMLEAGSLVVKAETASATFIVAGRELSYQISTGSLRNPLNLSVLREFRCPTGI
 
Nucleotide Sequence: 3537 bp     [Download]
>gi|27375111|ref|NC_004463.1|:3979809-3983345 Bradyrhizobium japonicum USDA 110 chromosome, complete genome
ATGCTTGCCAAGGACGTTCTTCGCATCGTTCTCTACGGGGTCGGGCTCAGCTCGCTCGGAGCGGTGATCT
ATTTCGCCGGTCCCTTCATTGCGTTCGGCGATTGGCGGCCGCTGGAGAACCATATCGTCCGGCAGATCGC
TATTCTGCTGCTCACCACGATCGTCGCAGGCATCGTTGGCCTCAATCTGTTCAAGCGGCGCAAGGGTGCC
AAGGAGATTGCCGATGGCATCGCTGGTGCGGACCAGCCCGTCAGCGATGAACCGGTGCTCAAGGAGCGCA
TGAAGGATGCGCTCGCGACGCTGAAGACCGCCAGCGGCAACAAATCGGGCTTTCTCTACGATCTGCCGTG
GTACGTCATCATCGGTCCGCCCGGCGCCGGCAAGACCACGGCGCTGGTCAATTCCGGGCTCAAATTTCCG
CTCGCGCGCGGGGCGACGCCCGCGGCGATCGCGGGGGTCGGCGGTACCCGCTACTGCGATTGGTGGTTTA
CCGAGGAGGCGGTGCTGATCGATACCGCCGGCCGCTACACCACCCAGGACTCCAATAGCAAGGCCGACAA
GGACAGCTGGCTGGCGTTCCTGGACATCCTGAAGAAAAGTCGATCACGCCAGCCGATCAACGGCGTCCTT
GTCGCCATCAGTATCGAAGACATTCTAACGCTGCCGAAGCAGGAGCTCGCACTTCACGCCGATGCCATCA
GGATGCGCCTGCTCGAGCTGCATCAGAGGCTCAAGGTCAGCTTCCCGGTCTACGCGCTATTTACCAAAGC
TGATCTCGTTGCCGGCTTCACCGAGTATTTCGCCTATCTCGGGGATGCCGGCCGCCGCCAGGTCTGGGGG
GCCACGTTCCAGACCGCCGACAAGACCCAGAATCTGGTGGGGCAGATCCCGGTCGAGTTCGACCGTCTGC
TGGAGCGCCTGAGCGAGGAGACGCTCGACCGTCTGCAGGACGAGCCGACGCCCCAGCACCGCGTGCAATT
GTTCGGCTTTCCGGCACAGATGGCGCGGCTCAAGCCGCAGATCCACGATTTCCTCAACCTGATCTTCGAG
CCGACGCGCTATCACGTGAACGCGAACCTGCGCGGTTTCTACTTTACCTCGGGTACGCAGCAGGGCACGC
CGATCGACCAATTGATCGGGTCGCTGGCACGTACGTTCGGCGCTGAGGAGGTCGGTTCCGGATCCTATTC
GGGCACGGGCAAGAGCTTTTTCCTCGCCGATCTGATCTCCAAGGTCATCATCGGCGAAGCCGACTGGGTC
TCGACCGACCGTGCCGCGGTGCGCCGCGCGCTAATCCTGAAAACCGCGGCCCTGTCATTGATCGGCCTGG
TCTCGATCGGACTGATCGCAGCCTGGCTGACGAGCTACAAGCGGAACTCCGATTTGATTGAGCAAAGCCT
GCAGGCCGATAGCGAGTATGCAGCCGCCGGCGCACCAATTATCAAACAGACGCTGATTGCTGATCATGAT
CTAGACAAGGTGCTGCCGCTACTCTACCGGCTGCGAAACGCCCCGGCAGGCTACGGATCGCGCGGCGAGT
CGGTGCCTCTGTCGGCTCGCTACGGGCTCAGTCAGCACGCCCGGCTGCTGTCGCCCTCGAAGGCGGCCTA
TCATACGGCGCTTGAGCGCATGTTCCGGCCGCGGCTGCTGTATCGCCTGGAGGAGCAGCTCAATGCGCGC
ATAAACGAGCCTGCCTTTGTCTACGAGGCGCTCAAGGTCTATCTGATGGTCGGCGGCCTGCAGTCGCCGG
ACCGCGAGTTGATCCGCTCTTGGATGCAACGTGACTGGGCGGACAACCTCTATCCTGGCGCCACCAACGC
GGAAGGGCGGCGTCTGCTCGACGAGAACCTCGTGGCAATGTTCGACCTCGAGACCGAACAGCAGCCGCTG
GTCGAACTCGACGGCCGGTTGATCAAGCAGGCCCAGAGCTCCTTGGCGCGCCTGAGCGTGTCGCAACGTG
CCTACGAGTTTCTGAAATCGGAGGCTCGCGCATCGACCGCTGGCGACTGGATCGCCAGCCGCCATGGCGG
ACCCGACATGGGTGTCGTGTTCGAAACCACGACGGGGCAGCCTTTGGACGCCGTGCGGGTACCCGAGTTC
TTCACGTATAATGGCTTCCATCAGAAGTTCGTTGCCCGGCTGTCCGGATTGTCTGAGCGGATGAAGCGGG
AGCGATGGGTTCTAGGGGATGCCGGCCAGCAGTCGGCCATCGACCAGCAGTACGACAATCTGGCCGGCGA
TCTGCTCAGCATCTATTCCAACGATTTCGTGACGACCTGGCGAACGGCGCTCGGGAGCCTGCGCCTGAAG
AAGCTGCTCGCCGACAAGCCGAAATATGAGGTGCTGCGGGCGCTTTCGGCGCCGACCTCGCCGATGCGGC
AAATTCTGGAATCGGTGCGCGACGAGACGGTGCTAACCAAGGAACGGGCGAAGCCGGCGAGCGCTTCGGC
AGCCGCCGCCGCACCGGCGCCAGCACTCTTCACGAATGCCCAGGATGGACCGCCTGGCGCGATGATCGAG
GCGCAGTTCAAACCTTACCACGCGGCGCTCGAAGGCGAGAGCACCCGCCGGCCGATCGACTCGACCGTCG
CGAACCTGAACGACATCGCGCAGAACCTGACGCTGATCATCGAGAATCCCCAACTGACCGCACAGGCCAC
AGCTGCGCTTCAGACCCAGGTCGCAGCGCTCCGCAACAATGCCTCGCGCATGCCGCCGCCATTCTCCGAC
ATGCTGCGAGCAGCAGCCGCGGAGTTCGAAGGCAGCATTGCGGCTTCAACCGCCGGGCAAATCCTTCAAA
CGTTGCGCGATCAGGTCACGCCGGTCTGCCAACAGACCGTGACCAACCGCTACCCGTTTATCCGCAGCAG
CAGCCAGGAAGTCCCGCTGGCGGATTTTGCCAAATTGTTCAGTCCGAATGGTGTTATGGACAAGTTCTTC
ACCCAGTATCTGGCACCTTATGCCGACACGTCGCGATCGGACTGGGTTTGGCGAAAGGAGAGCCCCGTTG
GTCGGTCGTTCTCGCCGGATACGCTCAAGCAATTCCAAAATGCGGCCTATATCCGCGACGCCTTCTTCCA
GACCGGCGGCGGTTTGCCGGCGGTATCGTTCGCGATCCGGCCGCCTGGGGCAGCCGGGCCAGGCGTGACC
GTCAAGACCGAGATCGGCGGCACCACAATTACAAGCCCAACCACACCTGGTCCAGCGACCTCATCCTTGT
TCGGCGGTCCGCAACCTACGCCACCGCCACCGCCACAGAGCAACTCGCCAACGACCGTCCTATGGCCGGG
CCCCGCGCCGCGAACTGCAATTTCAGTCAGCAACGACACCGGCCCGCCATCCGTGCTTGAGCGCATTGGT
CCCTGGTCGTTGTTTCGGATGCTGGAGGCTGGCTCGTTAGTGGTGAAAGCGGAAACGGCCAGCGCGACTT
TCATCGTCGCCGGGCGCGAGCTCAGCTATCAAATTTCGACTGGATCGTTGCGCAACCCGCTGAATCTGTC
AGTGCTGCGTGAGTTTCGTTGCCCGACCGGGATATGA
 Primer design