SecReT6
Protein ID: 283779603
SecReT6 ID376
T6SS typei3
Gene symbol-
Locus tagPsta_1824
StrainPirellula staleyi DSM 6068
Repliconchromosome [GenBank: NC_013720] [Browse all T6SS(s) in this replicon]
Location [Strand]2313772..2315448 [-]
Producthypothetical protein
NoteTssM
UniProt IDD2QZL5
KEGG IDpsl:Psta_1824
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 2.40E-15, Aligned region: 303..515
Protein Sequence: 558 a.a.     [Download]
>gi|283779603|ref|YP_003370358.1| hypothetical protein Psta_1824 [Pirellula staleyi DSM 6068]
MSDEAPAEETKPEKKPEKKAKAPAQPGFFARLMAWPSKITTAGCASCLTSLVLTILLITVWIVFLVDSNN
VPWRHSMSWLRVTLEVMLVITIPIVLYYAIRLWMEGDKSPFPDIDYAWQTGLEQLSRSGLSLSSAPLFLI
VGTPGINQERSLMRASGVALRMRELPDGPAPLHWYAGPDGIYLFCTQASWASSLAALVEKRRNELIASGA
PPTDLSMPQNIVPAPVAPINTTASTPAPAKRAERNRGTIMLDQFVMEKQSLAAAAEASAQSSSQEVDDKD
DFVPSVSSSVSDQPALLSPQESSRQQQRLEYVCQLLRRGRRPLCPLNGVLTLLPFDVFQATQRETQEMQR
AVRADLTIIQNELTVRCPVTALITGMQNQRGFRELVRRVGRERAATQRFGRRFDVRMIATAEQVTNLCGQ
ITGVFEDWIHTLFREAEALSRPGNTRLYGLLCQMRSNLAGVLREVLSGGFGYESNQKNPAEPIAFSGCYF
AATGDTEDQQAFVRGVFEKLTEEQEEVEWTRLSVQINDLYQFVGILCGLASVVILVTVFVVFLVRLFS
 
Nucleotide Sequence: 1677 bp     [Download]
>gi|283777802|ref|NC_013720.1|:c2315448-2313772 Pirellula staleyi DSM 6068 chromosome, complete genome
ATGAGCGACGAAGCACCCGCTGAAGAAACCAAACCCGAAAAGAAGCCCGAGAAGAAGGCGAAAGCGCCCG
CTCAGCCCGGGTTCTTTGCGCGGCTGATGGCGTGGCCCAGCAAGATTACGACAGCCGGCTGCGCTAGTTG
CCTCACCAGTCTCGTCCTCACCATTCTGCTGATCACGGTTTGGATCGTTTTTCTCGTCGATAGCAACAAT
GTCCCGTGGCGACATTCGATGTCGTGGCTCCGGGTGACGCTCGAAGTGATGCTCGTCATCACGATTCCAA
TCGTGCTTTACTACGCCATTCGACTCTGGATGGAAGGGGACAAATCTCCTTTTCCCGATATCGACTACGC
CTGGCAAACGGGGCTCGAGCAACTTTCGCGGAGCGGTCTTTCTCTCAGCAGCGCGCCCTTGTTTCTGATT
GTCGGCACTCCCGGAATTAATCAGGAACGTTCGCTCATGCGAGCCTCGGGCGTAGCGCTGCGGATGCGAG
AACTTCCCGATGGTCCTGCGCCGCTGCACTGGTATGCCGGTCCCGACGGAATCTATCTGTTTTGCACCCA
GGCAAGCTGGGCCAGTTCGCTTGCGGCGCTCGTCGAAAAACGTCGCAACGAACTCATCGCTTCGGGCGCG
CCACCCACCGACCTCTCGATGCCGCAAAACATAGTTCCGGCACCGGTTGCGCCAATCAACACCACGGCCT
CGACACCCGCACCCGCCAAACGGGCCGAACGCAATCGTGGCACGATCATGCTCGATCAGTTCGTCATGGA
AAAACAATCGCTCGCTGCCGCTGCTGAAGCTTCAGCCCAATCGAGCAGCCAAGAGGTCGACGACAAAGAC
GATTTTGTCCCCTCCGTTTCGTCGTCGGTCAGCGATCAGCCTGCCCTGCTCTCGCCGCAAGAGTCGTCGC
GACAACAGCAGCGGCTCGAATACGTTTGCCAACTCCTGCGTCGCGGACGTCGGCCCTTGTGCCCGCTCAA
TGGTGTCCTCACACTGCTCCCATTCGACGTATTCCAGGCGACCCAGCGCGAAACGCAAGAGATGCAGCGT
GCCGTGCGCGCCGATCTCACGATCATTCAAAACGAACTCACGGTCCGCTGCCCTGTCACCGCTCTCATCA
CCGGCATGCAAAATCAGCGTGGCTTTCGCGAACTGGTTCGCCGCGTGGGACGCGAACGAGCTGCCACCCA
GCGTTTTGGTCGCCGCTTCGATGTCCGCATGATCGCCACCGCCGAACAGGTGACAAATCTTTGTGGACAA
ATCACCGGGGTCTTTGAAGACTGGATTCACACCCTCTTCCGCGAAGCAGAAGCCCTCTCGCGCCCCGGCA
ATACGCGACTCTACGGTCTGCTCTGCCAGATGCGCTCGAACCTTGCTGGCGTTCTCCGCGAAGTTCTCTC
CGGGGGCTTTGGCTACGAATCAAACCAAAAGAATCCAGCCGAACCGATCGCTTTCAGTGGCTGTTACTTC
GCCGCCACCGGCGACACCGAAGATCAGCAGGCGTTTGTGCGCGGGGTCTTTGAAAAACTGACCGAGGAAC
AAGAGGAAGTGGAATGGACGCGGCTGTCGGTCCAAATCAACGACCTCTATCAGTTTGTCGGCATCCTTTG
CGGACTCGCTTCGGTGGTCATTCTGGTTACGGTGTTTGTCGTCTTCCTGGTACGACTATTCTCCTAA
 Primer design