SecReT6
Protein ID: 28869740
SecReT6 ID41
T6SS typei1
Gene symbol-
Locus tagPSPTO_2549
StrainPseudomonas syringae pv. tomato str. DC3000
Repliconchromosome [GenBank: NC_004578] [Browse all T6SS(s) in this replicon]
Location [Strand]2815564..2817093 [+]
Productsigma-54 dependent transcriptional regulator
NoteSfa2
UniProt IDQ882S6
KEGG IDpst:PSPTO_2549
PDB IDNA
Domain hit(s) vs Pfam Sigma54_activat [PF00158], Evalue: 7.20E-67, Aligned region: 200..366
Sigma54_activ_2 [PF14532], Evalue: 3.60E-23, Aligned region: 201..370
HTH_8 [PF02954], Evalue: 2.60E-13, Aligned region: 356..363
HTH_8 [PF02954], Evalue: 2.60E-13, Aligned region: 459..497
HTH_30 [PF13556], Evalue: 2.20E-06, Aligned region: 470..499
AAA_5 [PF07728], Evalue: 1.80E-05, Aligned region: 223..341
GAF_2 [PF13185], Evalue: 7.80E-05, Aligned region: 32..153
GAF_2 [PF13185], Evalue: 7.80E-05, Aligned region: 263..293
GAF_3 [PF13492], Evalue: 0.0002, Aligned region: 33..155
GAF_3 [PF13492], Evalue: 0.0002, Aligned region: 207..259
Protein Sequence: 509 a.a.     [Download]
>gi|28869740|ref|NP_792359.1| unnamed protein product [Pseudomonas syringae pv. tomato str. DC3000]
MTSPFNALPDPLSYAQTLVSHYSILSQADERRSLLEGFVRAAAELSGCESSQLFLLDSKHKCLGLAAQIV
EGVIRSCSRKASPEDFCDLPLLRFSLLQNRVVSIPEISSSPYATDCLPVQEHAWQSLLCIPLPSRDNIPV
GLLVCASRQCRPLDGYAGSLGALGSFVISQLGLLALPDKPGSAASHPRRPAAKPAQFGLTGNSAALGRTT
HLLSKVLDSTCTILLTGETGTGKEVVSRALHEYGPRRLNAFVVQNCAAFPEALLESELFGYRKGAFTGAD
RDRRGLFDTAHGGTLLLDEIGDMPMLLQAKLLRVLQEGEIRPLGSNEVRKVDVRIIAATHRDLPKLIAEG
RFREDLYYRLAQFPIELPPLRKRVEDIEILARHFSDMACRQSQKEPVQWSEAALSVLSGYAFPGNIRELK
GFVERAVLLCEDNKLRPEHFPIASDSVSHPACLTLREHIEQFERGVLMECLRDSNGNRSRAARTLGVSRR
TLLYRLAHLKMGATHEKRD
 
Nucleotide Sequence: 1530 bp     [Download]
>gi|28867243|ref|NC_004578.1|:2815564-2817093 Pseudomonas syringae pv. tomato str. DC3000 chromosome, complete genome
ATGACCTCACCGTTCAACGCACTGCCCGACCCGCTGAGTTATGCGCAAACGCTGGTTTCACACTACTCGA
TCCTCTCACAGGCTGATGAAAGGCGATCCCTGCTGGAGGGTTTCGTCAGAGCGGCTGCCGAACTCAGCGG
CTGTGAATCAAGCCAGTTGTTTCTGCTCGATAGCAAACACAAATGTCTCGGCCTCGCTGCGCAAATCGTA
GAAGGCGTCATTCGGTCCTGCAGCAGGAAGGCATCACCGGAAGACTTCTGTGACTTGCCTCTGCTGCGTT
TCAGTCTGCTTCAAAACCGGGTCGTCAGTATTCCGGAAATCAGCAGCAGCCCCTACGCAACAGACTGTTT
GCCCGTGCAGGAACATGCATGGCAGTCACTGCTGTGCATTCCGCTGCCAAGCCGCGACAACATACCCGTC
GGGCTGCTGGTCTGTGCGAGCAGGCAATGCCGACCGCTGGACGGCTATGCAGGCTCACTGGGTGCATTGG
GCTCGTTCGTGATTTCTCAGTTGGGTCTGCTCGCGTTACCGGACAAGCCTGGCAGCGCCGCGTCTCACCC
GCGAAGGCCCGCCGCAAAGCCCGCGCAATTCGGGCTTACCGGAAACAGCGCAGCCCTGGGCCGCACAACC
CATCTTCTCAGCAAAGTGCTGGACAGCACCTGCACCATTTTGCTTACCGGTGAAACCGGGACAGGCAAGG
AAGTGGTATCTCGTGCCCTTCACGAGTACGGGCCTCGGCGCCTGAACGCCTTCGTCGTACAGAATTGTGC
TGCATTCCCGGAAGCTCTGCTGGAAAGCGAGCTGTTTGGCTATCGCAAGGGCGCTTTCACCGGTGCTGAT
CGGGATCGACGTGGCCTGTTCGATACGGCTCATGGCGGTACGCTTCTGCTTGATGAAATCGGTGATATGC
CGATGCTGTTGCAGGCAAAGCTGCTACGCGTATTGCAGGAGGGAGAGATTCGTCCGCTGGGCTCCAATGA
AGTGCGCAAGGTTGATGTACGAATTATTGCGGCCACCCATAGGGATCTTCCTAAGCTGATTGCCGAGGGG
CGCTTTCGTGAAGACCTTTACTACAGGCTGGCCCAGTTTCCCATTGAACTTCCTCCACTGCGTAAACGTG
TAGAGGACATAGAAATACTGGCCAGGCACTTCTCCGATATGGCCTGCCGCCAATCACAGAAAGAGCCTGT
GCAGTGGTCGGAAGCTGCGTTGAGCGTTTTATCCGGGTACGCCTTTCCAGGCAACATTCGGGAGTTGAAG
GGGTTCGTCGAGCGCGCAGTGCTGTTATGCGAAGACAATAAGTTGCGGCCCGAGCACTTTCCGATTGCCT
CCGATTCAGTGAGCCATCCGGCCTGTTTAACACTGCGCGAACACATCGAGCAGTTCGAGCGTGGCGTTCT
CATGGAGTGTTTGCGCGACAGCAACGGTAATCGCAGTCGTGCAGCCCGCACATTGGGTGTATCGCGCCGT
ACTCTGCTTTACCGTCTGGCTCATTTGAAAATGGGCGCCACTCATGAAAAGCGTGATTAA
 Primer design