SecReT6
Protein ID: 28869745
SecReT6 ID41
T6SS typei1
Gene symbol-
Locus tagPSPTO_2554
StrainPseudomonas syringae pv. tomato str. DC3000
Repliconchromosome [GenBank: NC_004578] [Browse all T6SS(s) in this replicon]
Location [Strand]2820042..2823548 [+]
Producthypothetical protein
NoteTssM
UniProt IDQ882S1
KEGG IDpst:PSPTO_2554
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 1.70E-74, Aligned region: 496..786
IcmF-related [PF06761], Evalue: 1.70E-74, Aligned region: 941..1001
ImcF-related_N [PF14331], Evalue: 2.20E-60, Aligned region: 197..446
DUF1215 [PF06744], Evalue: 2.50E-35, Aligned region: 903..1026
SRC-1 [PF08832], Evalue: 0.0048, Aligned region: 771..855
Amino_oxidase [PF01593], Evalue: 0.005, Aligned region: 284..346
Amino_oxidase [PF01593], Evalue: 0.005, Aligned region: 927..1001
Protein Sequence: 1168 a.a.     [Download]
>gi|28869745|ref|NP_792364.1| unnamed protein product [Pseudomonas syringae pv. tomato str. DC3000]
MKSLFKKLIEVLCKTWVWSLLLVFLLAASIWSFGPLLAVSDNRFWEGTSARLITISVLFLVWGLGMVFTN
WRGSLIKRQAEESETGKECLRKSVVMEKERLELASRFTDAQRVLKDSALFGELGARGRKELPWYVLIGPQ
GSGKTSLLDFSGLDFPLDRPARKLTRDTSSTGSCDWYFTHQAILLDTSGRYFDQPDPQVDGGAWMTLLGL
LQGRLRTQPLSGVLVTLPVDILLDGLDKRLEKVAGDVRVRLDEIFRRLHVDVPVYLVLTKADSIAGFDDF
FDQLSREESEQVLGTTFKKGQRGTDVDVISQAFETLLQRLGSQVITRIHQERDSQRRGRMLEFPNQLGGI
GRRLNIFAELAFSGNRYQRASQLRGFYLTRAPHVMQQGGQQPEPETGAGLPVQHGGRARFIHDLLRHVIF
PESDLAMLGKEARKKIQWRQKGMYCAALLFLAVSGALWATGFNANHDRLEKLRTLGEQWTRQTSSLTAED
DLLTILASLNTLYEAARVFPDSDEVALYERSGLYQGQPANEVLMRAYHAGLQTQLLPRMVSMFEARILDS
LRDREQLLSSLRAYLMLIQREHRLPSALETWATADWSIRYAGHAQAQRELNQHFKRLLALPFVYPANDAL
VAQARQVLRNESLATVVYRVLREKARVLPDYSLAHHTGPQEAVLAGADYRIPGLYTRQGYERYFVTHGTG
LVTEIMRDNWVLGEGAPFSVTQLRALMVELEKLYFRDYADHWAEAIGRVSLHPFEGPAQGAVQMAGLAAA
HSPLLRLLTEVRDNTRFPMLADSLDAAKTQVGKTVSTPAVLDQAVALGEQLQQSAASSLPETAKKSLQRR
FDALHRLLDEESGPSADLMAALNAVNELQMQMAALARSGQPDLAAYEMAKGRMSGQRDALNNLRSAATVL
PQPVGGWFDKLAEDTWSFVLYQSHHYLNQRYKAELYSFYEQSLDKRYPFHAHSSSDVALEDFREFFGPQG
IAERFFDNYLRPFVSGSPGNLRLRTLDGYSLPMSRAYLHQMAGVHDIRKSFFSTHTPEPQVQFTLEPYTL
DPGVRRAEFRLGDQSLEYRHGPIVPMGFKWPAGIDNGRASLVMDGRLGRPLGIEKNNGPWSLFRLFDLMQ
TEPLQGRDVLLLKADVGGMRAHYLLSSLRAPNPFDMTALRGFRMPAQL
 
Nucleotide Sequence: 3507 bp     [Download]
>gi|28867243|ref|NC_004578.1|:2820042-2823548 Pseudomonas syringae pv. tomato str. DC3000 chromosome, complete genome
ATGAAATCCCTCTTTAAAAAGCTCATTGAAGTGTTGTGTAAAACCTGGGTCTGGTCACTGTTGCTGGTGT
TTTTGTTGGCGGCATCGATATGGAGTTTTGGTCCGCTGCTGGCGGTGTCGGATAACAGGTTCTGGGAAGG
CACCAGCGCACGGTTGATAACAATCAGTGTGTTGTTTCTGGTGTGGGGGCTGGGGATGGTCTTTACCAAC
TGGCGCGGTAGCCTGATCAAAAGGCAGGCCGAGGAAAGTGAGACGGGCAAAGAGTGCCTGCGCAAGTCGG
TTGTGATGGAAAAGGAGCGCCTGGAACTTGCCAGTCGCTTCACGGATGCCCAGCGCGTCCTCAAGGATTC
CGCTCTGTTTGGAGAACTGGGCGCTCGCGGCCGCAAGGAGCTGCCCTGGTATGTATTGATCGGCCCTCAG
GGCAGTGGCAAGACCAGTCTGCTGGATTTTTCCGGGCTCGATTTCCCCCTCGACAGACCGGCTCGCAAAC
TGACTCGCGATACGAGCAGTACCGGCAGTTGCGACTGGTACTTCACACACCAGGCGATCCTTCTGGACAC
ATCGGGCCGCTATTTCGATCAGCCTGATCCCCAAGTGGACGGCGGCGCATGGATGACGCTGTTGGGGCTG
TTACAGGGACGTCTGCGAACGCAGCCGCTCAGCGGTGTGCTGGTGACATTGCCGGTGGATATTCTTCTTG
ATGGCCTGGACAAGCGTCTGGAGAAAGTCGCTGGAGATGTACGTGTTCGTCTGGACGAGATCTTTCGCCG
GTTGCACGTTGATGTTCCGGTTTACCTGGTGCTGACCAAAGCAGACTCGATAGCGGGTTTCGATGATTTC
TTTGATCAATTGTCTCGCGAGGAAAGTGAGCAGGTCCTTGGGACAACGTTCAAAAAAGGGCAGCGAGGCA
CCGATGTCGACGTCATCAGTCAGGCGTTCGAGACCTTGCTACAGCGCCTGGGCAGTCAGGTCATAACTCG
TATTCATCAGGAGCGCGACAGCCAGCGTCGGGGGAGAATGCTCGAGTTTCCCAATCAGCTTGGGGGCATC
GGACGCCGGCTGAATATTTTTGCCGAGTTGGCGTTTTCCGGGAACCGCTATCAGCGAGCCAGTCAATTGC
GTGGCTTTTACCTGACCCGTGCACCCCACGTCATGCAGCAGGGCGGTCAACAACCTGAGCCTGAAACCGG
TGCGGGTCTTCCTGTGCAACACGGTGGCCGCGCACGGTTTATTCATGATCTGTTACGTCATGTCATTTTT
CCTGAGTCCGATCTGGCCATGCTCGGCAAAGAAGCCCGGAAGAAAATCCAGTGGCGGCAAAAGGGCATGT
ATTGTGCAGCGCTGCTATTTCTGGCGGTGTCTGGTGCGCTCTGGGCGACCGGCTTCAATGCTAACCACGA
CAGGCTGGAAAAGCTTCGCACACTGGGTGAGCAGTGGACGCGGCAGACGTCATCGCTCACCGCCGAAGAT
GATCTGCTGACGATCCTGGCCAGCTTGAACACCCTTTACGAGGCCGCTCGGGTATTTCCGGACAGCGACG
AAGTCGCTCTGTACGAACGTAGCGGGCTTTATCAGGGACAGCCTGCCAACGAGGTACTTATGCGCGCCTA
TCACGCTGGTTTGCAGACGCAACTGCTGCCACGAATGGTCAGCATGTTCGAAGCCCGGATACTGGACAGC
CTGCGGGACCGCGAGCAATTGCTGAGCAGCCTTCGCGCCTATCTGATGCTGATTCAGCGAGAGCACCGGT
TACCTTCTGCACTGGAGACATGGGCCACCGCCGACTGGTCAATTCGCTATGCCGGGCACGCACAGGCTCA
GCGCGAGCTGAACCAGCATTTCAAGCGCTTGCTTGCGCTGCCTTTTGTCTATCCGGCCAACGATGCTCTG
GTGGCGCAGGCGCGTCAGGTGTTGCGTAATGAATCACTCGCCACTGTGGTTTATCGGGTACTGCGTGAAA
AAGCCCGGGTATTGCCGGATTACAGCCTGGCTCATCACACCGGGCCACAAGAAGCAGTGTTGGCAGGTGC
CGACTATCGAATTCCAGGGCTTTATACGCGTCAGGGTTACGAGCGGTACTTCGTCACACACGGCACCGGA
CTGGTGACTGAAATCATGCGTGACAATTGGGTACTGGGGGAGGGGGCACCGTTCAGCGTCACTCAATTGC
GCGCGCTGATGGTCGAGCTGGAAAAGCTGTACTTCCGGGATTACGCCGACCATTGGGCAGAGGCCATTGG
CCGGGTTTCATTGCATCCTTTTGAGGGGCCAGCTCAGGGCGCAGTGCAAATGGCAGGCCTGGCGGCGGCC
CATTCGCCTTTGCTGAGGTTGCTGACCGAGGTGCGCGACAACACGCGGTTTCCGATGCTTGCGGACAGCC
TTGACGCTGCGAAAACACAAGTCGGTAAAACAGTTTCAACCCCTGCAGTGCTTGACCAGGCGGTTGCTCT
TGGCGAGCAATTGCAACAGTCGGCTGCCAGTAGTTTGCCCGAGACAGCCAAGAAATCATTGCAGCGACGT
TTTGATGCGCTGCATCGATTGCTGGATGAGGAAAGCGGTCCCTCAGCCGACCTGATGGCTGCGCTGAACG
CCGTCAATGAGTTGCAGATGCAGATGGCCGCGCTGGCACGCTCCGGTCAACCTGATCTGGCTGCCTACGA
GATGGCCAAAGGGCGGATGTCCGGGCAGCGAGATGCACTGAACAACCTGCGCAGCGCGGCGACAGTGTTG
CCTCAACCCGTCGGCGGCTGGTTTGACAAGCTGGCTGAAGACACCTGGAGTTTCGTGCTGTATCAGTCTC
ACCACTATCTGAACCAACGCTACAAGGCCGAGCTTTACAGTTTCTATGAGCAGTCTCTCGACAAACGCTA
TCCGTTTCATGCCCACAGCAGCAGCGACGTGGCGCTTGAGGACTTTCGTGAATTCTTCGGGCCACAAGGC
ATTGCCGAGCGGTTTTTCGATAACTACCTGAGGCCTTTTGTCAGCGGCAGCCCGGGAAACCTCCGCTTGC
GCACCCTCGACGGTTACAGCCTGCCGATGAGTCGTGCCTACCTGCACCAGATGGCCGGCGTGCATGACAT
CCGCAAAAGCTTCTTCAGCACTCACACACCGGAGCCGCAGGTGCAATTCACCCTTGAGCCCTACACACTT
GACCCTGGCGTGCGCCGCGCGGAATTTCGTCTGGGCGATCAGTCGCTGGAGTATCGCCACGGTCCAATCG
TGCCGATGGGGTTCAAATGGCCGGCAGGCATCGACAATGGGCGCGCGAGTCTGGTCATGGACGGTAGGCT
CGGACGGCCGCTGGGCATAGAAAAGAACAACGGCCCATGGTCGCTGTTTCGCCTCTTCGACCTGATGCAG
ACCGAGCCTTTGCAAGGACGTGATGTGCTACTGCTCAAAGCCGATGTCGGCGGCATGCGCGCGCATTATC
TTTTGTCGAGCCTGCGCGCGCCCAATCCTTTCGATATGACTGCATTGCGCGGTTTTCGCATGCCTGCGCA
GCTTTGA
 Primer design