SecReT6
Protein ID: 28872524
SecReT6 ID42
T6SS typei1
Gene symbol-
Locus tagPSPTO_5416
StrainPseudomonas syringae pv. tomato str. DC3000
Repliconchromosome [GenBank: NC_004578] [Browse all T6SS(s) in this replicon]
Location [Strand]6155611..6156606 [-]
Productserine/threonine protein kinase
NoteStk1
UniProt IDQ87U91
KEGG IDpst:PSPTO_5416
PDB IDNA
Domain hit(s) vs Pfam Pkinase [PF00069], Evalue: 4.30E-39, Aligned region: 50..304
Pkinase_Tyr [PF07714], Evalue: 3.70E-23, Aligned region: 52..305
APH [PF01636], Evalue: 1.20E-05, Aligned region: 118..202
APH [PF01636], Evalue: 1.20E-05, Aligned region: 266..266
Protein Sequence: 331 a.a.     [Download]
>gi|28872524|ref|NP_795143.1| unnamed protein product [Pseudomonas syringae pv. tomato str. DC3000]
MRPNDDLLVNEEQDSNLTYFAFAKSHKAEAALAPTKASIGEMPDVLAGRYRIERLLGAGGMGAVYRAKDL
LSEQFGEPDPYVALKILSEEFAESPDASALLYSEFALTRRLRHNNVLRLHSFEVDTNCQRAFITMELMRG
LTLDKLLCERPLGLPWRELRDIALSLLDALAYSHARGVLHGDMKPSNVMLSEEGVRLFDFGLGQAEEGVM
PGLPHLSRERFNAWTPGYAAPELLEGQALSASADVYGVACVIFELAGGKHPFRRLPSTQARDERLERELK
APRNLPKHCWPALRSALRFDAQDRKITAKQLRDAFAVTSSRLQRLMPWCNG
 
Nucleotide Sequence: 996 bp     [Download]
>gi|28867243|ref|NC_004578.1|:c6156606-6155611 Pseudomonas syringae pv. tomato str. DC3000 chromosome, complete genome
GTGCGCCCGAACGACGACCTGCTGGTGAACGAAGAGCAGGACAGCAACCTGACCTACTTTGCGTTTGCCA
AGTCACACAAGGCAGAAGCTGCACTGGCGCCGACCAAGGCCAGTATTGGTGAGATGCCCGACGTGTTGGC
AGGTCGTTACCGTATCGAGCGACTGCTCGGCGCCGGTGGCATGGGCGCTGTCTACCGGGCCAAGGATTTG
CTGAGCGAACAGTTCGGCGAGCCCGATCCTTATGTGGCGCTGAAAATCCTCAGCGAAGAATTTGCCGAGT
CGCCGGACGCAAGCGCCTTGCTTTACAGCGAGTTCGCCCTGACCCGACGCCTTCGTCACAATAACGTGCT
GCGTTTGCACTCGTTCGAAGTGGACACTAACTGCCAGCGGGCTTTCATCACCATGGAACTCATGCGTGGG
CTGACTTTGGACAAACTGCTATGCGAACGGCCTTTGGGCCTGCCGTGGAGAGAACTGCGTGACATTGCAT
TGTCGTTGCTCGACGCACTGGCTTATTCACATGCTCGCGGCGTGTTGCATGGCGACATGAAACCCAGCAA
TGTCATGCTCAGCGAAGAAGGTGTGCGCCTGTTCGACTTTGGCCTTGGCCAGGCCGAGGAAGGCGTAATG
CCGGGGCTGCCTCACTTGAGTCGCGAACGTTTCAACGCTTGGACTCCGGGCTACGCAGCCCCGGAATTGC
TGGAAGGCCAGGCACTATCAGCCAGCGCCGATGTGTATGGCGTTGCCTGTGTAATTTTTGAACTGGCAGG
AGGCAAGCACCCGTTTCGCCGCTTGCCGTCGACCCAGGCGCGTGACGAGCGTCTTGAGCGTGAGCTGAAG
GCACCAAGGAATTTACCGAAACACTGCTGGCCTGCTTTGCGGTCAGCACTGAGATTCGATGCACAGGATC
GCAAGATCACTGCCAAACAACTGCGTGACGCTTTCGCCGTCACTTCGTCCAGGCTGCAACGCTTGATGCC
GTGGTGTAACGGATGA
 Primer design