SecReT6
Protein ID: 28872525
SecReT6 ID42
T6SS typei1
Gene symbol-
Locus tagPSPTO_5417
StrainPseudomonas syringae pv. tomato str. DC3000
Repliconchromosome [GenBank: NC_004578] [Browse all T6SS(s) in this replicon]
Location [Strand]6156615..6157343 [-]
Productserine/threonine phosphoprotein phosphatase
NoteStp1
UniProt IDQ87U90
KEGG IDpst:PSPTO_5417
PDB IDNA
Domain hit(s) vs Pfam PP2C_2 [PF13672], Evalue: 1.20E-16, Aligned region: 19..205
PP2C [PF00481], Evalue: 4.20E-14, Aligned region: 30..234
SpoIIE [PF07228], Evalue: 8.40E-09, Aligned region: 35..241
Protein Sequence: 242 a.a.     [Download]
>gi|28872525|ref|NP_795144.1| unnamed protein product [Pseudomonas syringae pv. tomato str. DC3000]
MLVASPWRSAARTDAGKVRARNEDAFLDSPQHGLWVVADGMGGHQGGDVASQLIVASLAELPVQEGFDER
LKGIRQCLHWLNRRLGQELTVTAGRHDSIMGSTVVALMVEGNRAACIWAGDSRCYLWRGQRLYQLSKDHS
LQQQLIDEEKMSVEQASAHPSAHALTRAVGAAEQLTLDVLELEVYPGDAFLLCSDGLYQGLGSDALGSAL
SLTAPQVALERLFDSALRGSARDNLTAVVIRK
 
Nucleotide Sequence: 729 bp     [Download]
>gi|28867243|ref|NC_004578.1|:c6157343-6156615 Pseudomonas syringae pv. tomato str. DC3000 chromosome, complete genome
ATGCTGGTAGCCAGCCCTTGGCGCAGCGCTGCGCGTACCGATGCCGGCAAGGTACGGGCGCGCAACGAAG
ATGCTTTTCTGGACTCCCCGCAGCACGGGCTGTGGGTGGTCGCGGATGGCATGGGCGGTCATCAGGGTGG
CGATGTCGCCAGTCAGTTGATCGTCGCCAGCCTGGCGGAACTGCCTGTGCAGGAAGGCTTTGACGAACGC
CTCAAGGGCATTCGTCAATGTCTGCACTGGCTCAACCGCCGTCTGGGTCAGGAACTGACGGTCACTGCGG
GTCGCCATGACAGCATCATGGGCAGCACGGTGGTAGCGCTGATGGTTGAGGGTAATCGCGCCGCCTGTAT
CTGGGCGGGCGATAGCCGTTGTTACTTGTGGCGCGGACAGCGTCTGTACCAGCTGTCCAAAGACCACTCG
CTGCAACAGCAATTGATCGACGAGGAGAAAATGAGCGTCGAACAGGCCAGTGCCCATCCTTCCGCGCACG
CCTTGACGCGCGCGGTCGGTGCGGCAGAACAGTTGACCCTGGATGTACTGGAGCTTGAGGTATATCCCGG
CGACGCATTTTTGCTGTGTAGCGATGGTTTGTATCAGGGACTTGGCAGCGATGCGCTCGGTAGCGCCTTG
AGTCTGACCGCGCCGCAGGTAGCGCTGGAGCGCTTGTTCGATAGTGCCTTGCGTGGTTCGGCGCGGGATA
ATCTGACGGCCGTGGTGATCCGCAAATGA
 Primer design