SecReT6
Protein ID: 28872526
SecReT6 ID42
T6SS typei1
Gene symbol-
Locus tagPSPTO_5418
StrainPseudomonas syringae pv. tomato str. DC3000
Repliconchromosome [GenBank: NC_004578] [Browse all T6SS(s) in this replicon]
Location [Strand]6157343..6160921 [-]
Producthypothetical protein
NoteTssM
UniProt IDQ87U89
KEGG IDpst:PSPTO_5418
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 1.80E-81, Aligned region: 518..809
IcmF-related [PF06761], Evalue: 1.80E-81, Aligned region: 966..1012
ImcF-related_N [PF14331], Evalue: 8.50E-77, Aligned region: 213..470
DUF1215 [PF06744], Evalue: 7.10E-34, Aligned region: 928..1048
AAA_16 [PF13191], Evalue: 0.0015, Aligned region: 149..268
AAA_16 [PF13191], Evalue: 0.0015, Aligned region: 295..340
AAA_16 [PF13191], Evalue: 0.0015, Aligned region: 492..568
AAA_16 [PF13191], Evalue: 0.0015, Aligned region: 845..882
Protein Sequence: 1192 a.a.     [Download]
>gi|28872526|ref|NP_795145.1| unnamed protein product [Pseudomonas syringae pv. tomato str. DC3000]
MIRRRSSRSHSRKQGRMMKNFFKKVGAFLRKTWVWTLLLVLFVALLVWFVGPLLAVDDYRFWESSTSRLL
TISVLFLIWGLTMVFVSWRSGVRKKALEESEDGQDRIRREEQIDEEQKELKTRFKDALKTLKTSSLYRGR
SERWRSDLPWYLLIGPQGSGKTSLLDFSGLEFPINKIERKLTRDTLGTRHCDWYFADHGVLIDTAGRYLT
QPDAEVDGSAWNTLLDLLRKRRRNRPLNGVLVTIPVETLLNESEQNLETLARQVRARLQDVHQKLHVDVP
IYLVLSKADRLLGFEEFFDQLTREESDQVLGTSFRKEQMGTDVAVLRTEFEELLRRLNSQVIMRMHQERD
TQRRGRILDFPHRLGQIGERLCLFVDLAFTGNRYQRVSQLRGFYLTSAPHLTEEMDATTAGIGANLGMSA
GVLPTLRSGRSRFIHHLLSRVIFPEADLAGLDKRERSRIHWGQRALYVGALVALALFGVLWAGGFSANYS
RLENLRSLAQTWTQQRSALSARDDSMAVLKTLDTSYAATQVFPEKGDVSYHERGGLYQGEDVNPVVRVAY
ERELHDQLLPRVANLLESQIRANTKDRDRLLNSLRAYLMLNMTDRRDAQWLKDWVATEWSQRYTGNTAVQ
NGLNTHFDRLLKQPFSYPLNDPLVAQARQILRSESLATVVYRMLREQARNLPEYTLGQHLGPQGALFVGT
DYTIPGFYTQQGYQQYFSVQGTKLVTDILSDNWVLGEGAGLSTMDLRRLMVELEQLYFRDYANYWGEAIG
EVQLPAINDFGEGAEQLAGLTSANSPVIQLLIEVRENTRFPVVADSAEEAADAAGQLAENGGKLGKLAVA
AAGKASDALAKKLPDTARKSLQSRFEPLHRLLDDNNGPTADLTPALAALNELQLQMASLARSSSPDQAAF
EMAKSRMGGQRDALSNLRTASGRLPRPVGVWFNVLAEDTWRLVLGDSYQYLNQRYQSELYSFYGKAISKR
YPFDAHSASDVAISDFREFFKAQGIADRFFDNYMRPFVSGDAGNYRMRSVDGYSLPVSKVYLDQMAAALV
IRQSFFADNPAEPQVQFKLEPYTLDPAVSRSEFKFGDKTIEYRHGPIVPVSFKWPTDAEDGRTSLVLDRM
VGRPLGLEKNTGPWSLFRLFDLMQTEYLTGRDVLVLKADVGGLRANYLLTSQRTPNPFDMGALRTFRMPG
QL
 
Nucleotide Sequence: 3579 bp     [Download]
>gi|28867243|ref|NC_004578.1|:c6160921-6157343 Pseudomonas syringae pv. tomato str. DC3000 chromosome, complete genome
TTGATCCGGCGGCGGTCCAGCCGCAGTCACAGCCGTAAACAGGGACGCATGATGAAAAACTTCTTCAAGA
AAGTCGGCGCATTCCTGCGCAAGACATGGGTCTGGACGCTGCTGCTGGTGCTGTTTGTTGCGCTGTTGGT
GTGGTTCGTCGGACCGCTGCTGGCGGTTGATGATTACAGGTTCTGGGAAAGCTCCACCTCGCGTTTGCTG
ACTATCAGTGTGCTGTTCCTGATCTGGGGCCTGACGATGGTTTTCGTCAGTTGGCGCTCGGGTGTTCGCA
AGAAAGCCCTCGAAGAAAGCGAAGACGGCCAGGATCGCATCCGCCGAGAAGAGCAGATCGACGAAGAGCA
GAAAGAACTGAAAACGCGTTTCAAGGACGCGTTGAAAACGCTGAAAACGTCGAGCCTTTATCGCGGCCGT
AGCGAACGCTGGCGCAGCGATCTGCCTTGGTACCTGCTGATTGGTCCGCAAGGCAGTGGTAAAACCAGCC
TGCTGGATTTCTCGGGCCTTGAGTTTCCAATCAACAAGATTGAACGCAAACTGACACGAGACACTCTGGG
CACCCGTCACTGTGACTGGTACTTCGCCGATCACGGCGTGCTCATCGACACCGCTGGCCGCTACCTGACC
CAGCCTGACGCCGAAGTCGACGGCAGTGCCTGGAACACCTTGTTGGACCTGCTGCGCAAACGTCGCCGCA
ATCGTCCGCTGAACGGTGTACTGGTGACCATTCCGGTTGAAACCCTGCTGAATGAAAGTGAGCAGAACCT
TGAAACACTCGCTCGTCAGGTGCGTGCGCGTTTGCAGGACGTGCATCAGAAACTGCACGTCGATGTGCCC
ATCTATCTGGTTCTGAGCAAGGCCGACCGCTTGTTGGGCTTTGAAGAGTTCTTCGATCAACTGACGCGTG
AAGAAAGCGATCAGGTCCTCGGCACGAGCTTTCGCAAAGAGCAGATGGGCACCGATGTGGCGGTGTTGCG
CACCGAGTTCGAAGAGCTGCTGCGTCGCCTGAACAGTCAGGTGATCATGCGCATGCATCAAGAGCGTGAC
ACGCAGCGTCGTGGTCGTATTCTCGACTTCCCGCATCGACTGGGGCAGATCGGCGAGCGCCTGTGCCTGT
TTGTCGATCTGGCATTCACGGGTAACCGCTACCAGCGCGTCAGTCAGTTGCGCGGCTTCTACCTGACCAG
TGCGCCGCATCTGACAGAGGAAATGGACGCTACCACCGCTGGCATCGGCGCCAATCTGGGCATGAGTGCA
GGTGTACTGCCAACGCTTCGCAGCGGCCGATCACGATTCATCCATCATCTGCTCAGCCGGGTGATCTTTC
CGGAAGCCGATCTCGCGGGACTGGACAAGCGTGAGCGCAGTCGCATCCATTGGGGCCAACGTGCGTTGTA
CGTGGGCGCGCTGGTAGCGTTGGCGCTGTTCGGCGTACTGTGGGCTGGCGGCTTTTCGGCCAACTATTCA
CGTCTGGAAAACCTGCGCAGTCTGGCTCAGACCTGGACTCAGCAACGTTCGGCGCTGAGCGCCCGCGATG
ACTCCATGGCGGTGCTCAAAACGCTCGACACCAGTTACGCAGCCACTCAAGTGTTCCCGGAAAAAGGCGA
CGTGAGTTATCACGAGCGTGGCGGCCTGTATCAAGGCGAAGACGTCAATCCGGTGGTCAGGGTCGCTTAC
GAACGTGAGCTTCACGACCAGTTGCTGCCCCGCGTTGCAAACTTGCTGGAAAGCCAGATCCGCGCCAACA
CCAAGGATCGCGACCGCCTGCTCAACAGCCTGCGTGCGTACCTGATGCTGAACATGACGGATCGCCGCGA
CGCTCAGTGGCTCAAGGATTGGGTCGCTACTGAATGGTCCCAGCGCTATACCGGCAACACCGCGGTACAG
AACGGTTTGAACACCCATTTTGATCGTTTATTGAAACAGCCATTCAGCTATCCGTTGAATGATCCGCTGG
TGGCTCAGGCGCGTCAGATTCTGCGTAGCGAGTCTTTGGCGACTGTGGTTTACCGCATGCTGCGCGAGCA
GGCCCGTAATCTGCCGGAATACACTTTGGGCCAGCACCTTGGTCCTCAGGGTGCGCTGTTTGTCGGCACC
GATTACACGATCCCCGGCTTCTATACCCAACAGGGCTACCAGCAGTACTTCTCGGTTCAGGGCACCAAGC
TGGTTACTGACATCCTTAGTGATAACTGGGTGCTGGGTGAAGGTGCCGGTCTCAGCACGATGGACTTGCG
CCGCCTGATGGTTGAACTGGAGCAGCTGTACTTCCGCGACTACGCCAACTATTGGGGGGAGGCGATAGGT
GAGGTCCAACTGCCAGCAATCAATGACTTTGGGGAAGGCGCTGAGCAGTTGGCAGGTCTGACGTCAGCCA
ACTCCCCGGTCATCCAGTTGCTGATAGAGGTGCGTGAAAATACACGCTTCCCGGTGGTTGCCGATTCGGC
GGAAGAAGCTGCCGATGCAGCAGGGCAACTGGCAGAGAATGGTGGCAAGCTTGGCAAACTGGCCGTTGCC
GCAGCAGGCAAGGCATCTGATGCATTGGCGAAAAAGCTGCCGGATACCGCGAGGAAGTCTCTGCAAAGTC
GCTTCGAGCCGTTGCACCGCTTGCTGGATGACAACAATGGGCCGACTGCCGACCTGACGCCTGCCCTGGC
CGCTCTTAATGAGCTGCAACTGCAGATGGCGAGCCTTGCACGTTCCAGCTCGCCGGATCAGGCCGCCTTT
GAAATGGCCAAAAGCCGAATGGGTGGCCAGCGCGACGCGCTGAGCAATCTGCGCACGGCGTCCGGTCGTT
TGCCGCGTCCGGTGGGCGTATGGTTCAACGTTCTGGCTGAAGACACCTGGCGTCTGGTGCTGGGCGATTC
CTATCAGTACCTGAACCAGCGCTACCAGAGCGAGCTGTACAGCTTCTATGGCAAAGCGATCAGCAAGCGC
TATCCGTTCGACGCGCACAGCGCCAGCGATGTGGCAATCAGCGACTTCCGTGAGTTCTTCAAGGCTCAGG
GCATTGCCGATCGCTTCTTCGATAACTACATGCGTCCGTTCGTGAGTGGCGATGCAGGCAACTATCGCAT
GCGTAGCGTCGATGGCTACAGCCTGCCGGTTTCCAAGGTCTATCTCGACCAGATGGCCGCGGCACTGGTG
ATCCGCCAAAGCTTCTTCGCCGACAACCCGGCCGAGCCGCAGGTGCAGTTCAAGCTGGAGCCTTACACAC
TTGACCCGGCTGTCAGCCGCTCCGAGTTCAAGTTTGGCGACAAGACCATTGAATACCGTCACGGTCCGAT
CGTACCGGTGTCCTTCAAATGGCCTACAGATGCGGAAGACGGCCGCACCAGCCTGGTACTCGACAGAATG
GTGGGTCGTCCGCTGGGTCTTGAGAAGAATACCGGCCCATGGTCGCTGTTCCGTCTGTTCGACCTGATGC
AGACCGAATACCTGACCGGACGTGACGTGTTGGTGCTCAAGGCTGACGTGGGTGGTCTGCGCGCCAACTA
CCTGTTGACCAGCCAGCGTACGCCGAACCCGTTTGACATGGGCGCACTGCGTACCTTCCGCATGCCGGGG
CAGCTTTGA
 Primer design