SecReT6
Protein ID: 28872532
SecReT6 ID42
T6SS typei1
Gene symbol-
Locus tagPSPTO_5424
StrainPseudomonas syringae pv. tomato str. DC3000
Repliconchromosome [GenBank: NC_004578] [Browse all T6SS(s) in this replicon]
Location [Strand]6165047..6166564 [-]
Productsigma-54 dependent transcriptional regulator
NoteSfa2
UniProt IDQ87U83
KEGG IDpst:PSPTO_5424
PDB IDNA
Domain hit(s) vs Pfam Sigma54_activat [PF00158], Evalue: 2.50E-70, Aligned region: 196..363
Sigma54_activ_2 [PF14532], Evalue: 2.10E-22, Aligned region: 197..367
HTH_8 [PF02954], Evalue: 2.70E-10, Aligned region: 353..360
HTH_8 [PF02954], Evalue: 2.70E-10, Aligned region: 456..495
AAA_5 [PF07728], Evalue: 0.00023, Aligned region: 220..319
HTH_30 [PF13556], Evalue: 0.00025, Aligned region: 452..468
HTH_30 [PF13556], Evalue: 0.00025, Aligned region: 465..496
GAF_2 [PF13185], Evalue: 0.0017, Aligned region: 36..147
GAF_2 [PF13185], Evalue: 0.0017, Aligned region: 259..293
GAF_3 [PF13492], Evalue: 0.002, Aligned region: 30..172
GAF_3 [PF13492], Evalue: 0.002, Aligned region: 264..309
Protein Sequence: 505 a.a.     [Download]
>gi|28872532|ref|NP_795151.1| unnamed protein product [Pseudomonas syringae pv. tomato str. DC3000]
MFTQMPQPLAYAQALLAQFASLARAVNGAQLLGDFVRSLAELSGCELSQLYLLDATHKCLKMRAECLDGT
LQPREAASLPVDYNGEQLLQFALCQNRVVCLGELSGSLHETSFLPTQSTPWQSLLCVPVVNHQQAVEGLL
LCASRRHVDLQGFADSLGQFGSFALGQLNLLQRLHKPADEVRPAGITMPSVSGYGLIGKSASMRQTYTMI
SKVLHSPYTVLLRGETGTGKEVVARAIHDFGPRRSQPFIVQNCAAFPEHLLESELFGYRKGAFTGADSDR
TGLFEAANGGTLLLDEIGDIPLPLQAKLLRVLQEGEIRPLGCNDTRKIDVRILAATHRDLSAMVSEGKFR
EDLYYRLAQFPIELPALRNREGDILDLARHFVDKTCAFLQRSPLRWSDAALDLLSGYTFPGNVRELKGLV
ERAVLLCEGSELLVEHFSLRPEVVPEGSSLNLRERLEQVERSLLLDCLRKNDGNQTLSARELGLPRRTLL
YRLGRLNINLGDLNG
 
Nucleotide Sequence: 1518 bp     [Download]
>gi|28867243|ref|NC_004578.1|:c6166564-6165047 Pseudomonas syringae pv. tomato str. DC3000 chromosome, complete genome
ATGTTCACTCAGATGCCGCAGCCTCTGGCATATGCCCAAGCCTTGTTGGCGCAATTCGCCAGCTTGGCGC
GGGCGGTGAATGGTGCCCAATTGCTGGGTGATTTTGTACGTAGCCTCGCTGAGCTCAGCGGCTGCGAGCT
GTCGCAGCTTTATCTGCTGGACGCCACTCATAAGTGTTTGAAGATGAGAGCCGAGTGCCTGGACGGCACG
CTGCAACCGCGGGAAGCGGCAAGCCTGCCGGTGGATTACAACGGCGAACAGCTGTTGCAATTTGCCCTTT
GTCAGAATCGTGTGGTTTGCCTTGGCGAACTGAGCGGCAGCCTGCACGAAACCAGTTTTCTGCCGACGCA
AAGTACGCCGTGGCAGTCGCTGCTTTGTGTCCCGGTCGTCAACCATCAGCAAGCCGTCGAAGGCTTGTTG
TTGTGCGCAAGTCGCCGACATGTCGATCTGCAGGGTTTTGCTGATTCTCTCGGTCAGTTCGGCTCGTTCG
CACTGGGTCAACTCAACCTGCTGCAACGTTTGCATAAGCCTGCGGATGAGGTACGACCGGCAGGGATCAC
TATGCCAAGCGTCAGCGGATACGGTTTGATCGGAAAAAGCGCAAGCATGCGTCAGACCTACACGATGATC
AGCAAGGTGCTGCACAGCCCGTACACTGTGTTGCTGCGGGGAGAGACAGGCACCGGCAAAGAAGTCGTTG
CCCGGGCGATTCACGACTTCGGTCCGCGTCGCTCTCAGCCTTTCATTGTTCAGAACTGTGCGGCATTTCC
AGAGCACCTGCTTGAAAGCGAGCTTTTCGGCTATCGCAAAGGAGCCTTTACAGGTGCCGACAGTGATCGT
ACCGGGCTGTTCGAGGCTGCCAATGGCGGCACACTGTTGCTCGACGAAATCGGCGACATTCCCCTGCCGC
TGCAAGCCAAGCTGCTGCGCGTGCTGCAAGAGGGCGAGATTCGCCCATTGGGTTGCAACGATACGCGCAA
GATCGACGTGCGTATTCTTGCAGCAACGCATCGTGACCTGTCGGCGATGGTCAGCGAAGGCAAATTCCGC
GAGGACTTGTATTACCGTCTTGCGCAATTTCCCATTGAGCTGCCTGCCCTGCGCAATCGAGAGGGTGACA
TTCTCGACCTGGCGCGGCACTTCGTCGACAAGACGTGTGCGTTCTTGCAACGTAGCCCTTTGCGCTGGTC
GGACGCAGCTCTTGATCTCCTGTCCGGTTATACGTTTCCCGGCAATGTGCGCGAACTCAAAGGCCTGGTC
GAGCGTGCTGTCCTGCTCTGCGAGGGCAGCGAGTTGCTTGTGGAGCATTTCTCTCTGCGCCCGGAAGTTG
TGCCTGAAGGCAGCAGCCTCAATCTGCGCGAGCGGCTGGAGCAGGTGGAGCGCAGCCTGTTGCTTGATTG
CCTGCGCAAGAACGACGGCAACCAGACTCTTTCCGCGCGTGAACTCGGCCTGCCGAGGCGCACGCTGCTT
TACCGTTTGGGACGCCTGAATATCAACCTGGGTGACTTAAATGGTTAG
 Primer design