SecReT6
Protein ID: 288935817
SecReT6 ID377
T6SS typei2
Gene symbol-
Locus tagKvar_2958
StrainKlebsiella variicola At-22
Repliconchromosome [GenBank: NC_013850] [Browse all T6SS(s) in this replicon]
Location [Strand]3079319..3082744 [-]
ProductImcF domain-containing protein
NoteTssM
UniProt IDD3RI31, D3RI31
KEGG IDkva:Kvar_2958
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 8.50E-69, Aligned region: 416..734
DUF1215 [PF06744], Evalue: 1.60E-33, Aligned region: 857..977
Protein Sequence: 1141 a.a.     [Download]
>gi|288935817|ref|YP_003439876.1| ImcF domain-containing protein [Klebsiella variicola At-22]
MDNVNKPAAISVAATVIVCIAAVTLLVLLGGLAWWLWAMDRATQWETLRPLIATGFIIWGMALSLLVLGF
MAFRLLIKDKVKPSAAPVRQPTRPAGREALYAPLKKHLHARYRLRWRRKVRLLLVTGDDAAIEQLAPGLR
QQQWLEGNRTVLIYGGNLITEPDQEKYAALRKLRRGRPLDGIVRVMPSSLTLTPQISESDLHGLEKISEL
LGYAAPVWLWKLCDSEWSQADRAVQAVGVSFPLRATEDDVARQLAQMLPTLREQGMRQIAADTRHDFLLR
LGQRLIDGGIAQWRWQLAPWLTASRQRLALRGLMFSLPEPRTVDPYQEADALPANQPHLLTLPATWQGIV
DDCRRLRGHHVGMAWERGLACGLLAILGLWAAGLLLSFALNYSQIATVAGKARDLVAHPSVSDYQLTALH
ALRNEAGRLVHDGQKGAPWYRCFGLDHHQQLLNAVLPWYGVANHRLIRDPANAALQQALSTLVNSAPNSD
QRAQLAKPGYDQLKAWLMMARPDKADGAFFAQTMKAVQPTRMGISTGLWQSLAPDLWAFYLSLLPERPEW
KIIPDAQRVSQSRQVLLQQLGRRNAESTLYENMLKSVRRNFADVSLEDMTSGTDARRLFTTDEVVPGMFT
RQAWEGGIQQAIDKAASSRREEIDWVLSDSRKTMSTDLSPEALKARLTRRYFTDFAGSWLNFLNSLRLNP
TTNIADVTDQLTLISDVRQSPLIALMNTLAWQGQAGQQREGLSDSLIKSAKDLVGGKDKPVIDQSATGPQ
GPLDDTFGPLLQLMGKNTGSNVMSADSTLSLQTYLTRITRVRLRLQQVANASDPQEMMQTLAQTVFQGKS
VDLTDTQQYGSLISASLGEEWSGFGNTLFVQPLTQAWETVLLPSAASLNDKWRRSVVANWHTAFDGRFPF
AASKSDASLPMLAEFVRKDSGRIERFLTTELNGVLHKEGSQWVPDKVNSHGLVFNPAFLRAIDQLSQLSD
ILFTDGSQGISFELQARPAPEVVETQLTIDGQKLRYFNQMADWQTFRWPGETYKPGTLLTWTTVNAGTRL
FGDYSGTWGFIRWLEQGKRHPLDRSQWMMSFSAPDGRTLQWVLRSQLGSGPLALLALRGLTLPDQIFTVD
AAESAQALTTGVGNSDMDEME
 
Nucleotide Sequence: 3426 bp     [Download]
>ref|NC_013850.1|:c3082744-3079319 ImcF domain-containing protein [Klebsiella variicola At-22]
ATGGACAACGTCAATAAACCTGCCGCTATCTCTGTGGCGGCTACGGTTATCGTCTGTATTGCTGCGGTCA
CGCTTCTGGTGCTCCTGGGCGGGCTGGCATGGTGGCTGTGGGCGATGGATCGTGCCACGCAGTGGGAAAC
GCTGCGCCCGCTTATCGCCACGGGCTTTATTATCTGGGGGATGGCACTCAGCCTGCTGGTACTGGGGTTT
ATGGCCTTTCGACTGCTGATAAAAGATAAGGTTAAGCCTTCAGCAGCGCCTGTGCGGCAACCCACCAGGC
CCGCCGGGCGCGAAGCCCTTTATGCCCCGCTGAAAAAGCACCTTCACGCACGTTACCGCCTGCGCTGGCG
CCGCAAAGTCCGCCTGCTGCTGGTTACCGGGGACGATGCAGCAATCGAACAACTGGCGCCTGGTCTGCGT
CAGCAGCAGTGGCTTGAAGGTAACCGCACTGTGCTGATTTACGGCGGTAACCTGATCACAGAGCCCGACC
AAGAAAAATACGCCGCGCTGCGCAAGCTGCGCCGCGGCCGTCCTCTGGACGGGATTGTGCGGGTGATGCC
GTCGTCTCTCACCCTGACGCCGCAGATAAGCGAGAGCGACCTGCACGGGCTGGAAAAAATCAGCGAACTG
CTGGGCTATGCCGCCCCGGTCTGGCTGTGGAAACTGTGCGACAGTGAGTGGTCGCAGGCTGACCGCGCGG
TACAGGCGGTAGGCGTTAGCTTCCCGTTGCGCGCCACTGAGGACGATGTCGCCCGTCAGCTTGCGCAGAT
GTTGCCCACGCTGCGGGAGCAGGGGATGCGCCAGATCGCAGCAGATACCCGCCACGACTTTCTGCTGCGT
CTGGGGCAGCGGCTTATCGACGGGGGGATCGCGCAATGGCGCTGGCAGCTGGCGCCGTGGCTGACCGCCT
CGCGGCAGCGGCTTGCGCTGCGTGGCCTGATGTTTAGCCTGCCAGAGCCTCGTACCGTAGATCCGTATCA
GGAAGCTGATGCCCTGCCTGCGAACCAGCCTCATCTCCTGACGCTGCCCGCGACCTGGCAGGGGATCGTC
GATGACTGCCGCCGTTTACGCGGGCATCACGTGGGAATGGCATGGGAGCGGGGCCTGGCGTGCGGTCTGC
TGGCCATCCTCGGCCTGTGGGCAGCGGGACTGCTGCTCTCCTTTGCCCTTAATTACAGCCAGATTGCTAC
AGTCGCGGGAAAAGCCCGCGACCTGGTGGCCCACCCCTCTGTTTCTGACTATCAACTGACGGCCCTCCAT
GCCCTGCGCAATGAGGCCGGCCGTCTCGTGCACGATGGGCAGAAGGGCGCTCCCTGGTATCGGTGCTTTG
GTCTGGACCATCATCAGCAGCTATTAAACGCCGTCCTGCCCTGGTACGGTGTGGCAAATCATCGCCTGAT
ACGTGACCCGGCCAATGCCGCGTTGCAGCAGGCGCTCAGCACGCTGGTCAACTCCGCCCCCAATAGCGAC
CAACGAGCCCAGCTGGCGAAACCGGGCTATGACCAGCTGAAAGCCTGGCTGATGATGGCTCGTCCGGATA
AAGCCGATGGCGCATTTTTCGCGCAGACCATGAAAGCGGTCCAGCCGACGCGAATGGGGATCTCGACCGG
TCTGTGGCAAAGTCTGGCGCCGGATTTGTGGGCCTTTTATCTCTCCCTGCTGCCCGAGCGGCCAGAGTGG
AAGATCATCCCGGATGCGCAACGGGTGAGTCAGAGCCGTCAGGTTCTGTTGCAGCAGCTAGGTCGCCGCA
ATGCCGAAAGCACCTTATATGAGAACATGCTCAAATCCGTGCGTCGTAATTTTGCCGATGTGTCGCTGGA
AGACATGACCAGTGGCACCGACGCGCGCCGCCTGTTTACCACCGATGAAGTGGTCCCGGGGATGTTTACC
CGCCAGGCATGGGAAGGCGGCATTCAGCAGGCCATTGATAAGGCAGCCAGCTCGCGCCGGGAGGAAATCG
ACTGGGTGCTGAGCGATTCGCGCAAAACGATGTCGACAGATCTGTCGCCGGAGGCGCTGAAAGCGCGTCT
GACCCGACGCTACTTCACCGATTTCGCCGGCAGCTGGCTGAATTTTCTCAACAGTCTGCGACTCAACCCG
ACGACCAATATCGCCGATGTTACCGACCAGCTCACGCTGATAAGCGATGTCCGTCAGTCACCGCTGATTG
CCCTGATGAATACCCTTGCCTGGCAGGGGCAGGCGGGGCAACAAAGGGAGGGGCTGTCGGACAGCCTTAT
TAAATCGGCCAAAGACCTGGTGGGCGGGAAAGACAAGCCGGTCATCGACCAGTCGGCAACCGGCCCGCAG
GGGCCTCTGGATGACACGTTCGGCCCACTGCTCCAGCTGATGGGGAAAAACACGGGCAGCAACGTCATGT
CGGCCGATAGCACCCTGAGCCTGCAAACCTATCTGACCCGTATCACCCGCGTGCGCCTGCGCCTGCAGCA
GGTTGCGAATGCCTCCGATCCGCAGGAGATGATGCAGACCCTGGCGCAGACCGTCTTCCAGGGGAAAAGC
GTCGACCTGACCGACACGCAACAGTACGGTAGCCTGATTTCGGCGAGTCTTGGCGAAGAGTGGAGTGGCT
TCGGTAATACTCTGTTTGTGCAGCCGCTAACTCAGGCCTGGGAAACCGTGCTTCTGCCGTCGGCGGCCAG
TCTGAATGACAAATGGCGCCGATCGGTGGTCGCCAACTGGCACACCGCCTTTGACGGACGCTTTCCGTTT
GCCGCCAGCAAAAGCGACGCCTCCCTGCCGATGCTGGCTGAGTTTGTGCGCAAAGACAGCGGGCGAATCG
AACGTTTTCTCACGACGGAGCTGAACGGTGTCCTGCATAAAGAAGGTAGTCAGTGGGTGCCGGATAAGGT
CAACAGTCACGGCCTGGTCTTTAATCCGGCCTTTCTGCGCGCGATCGACCAGCTAAGCCAGCTGTCCGAC
ATTCTTTTCACCGACGGCAGCCAGGGGATCAGCTTTGAGTTACAGGCCAGGCCTGCCCCGGAGGTTGTCG
AGACACAGCTGACGATAGACGGCCAAAAGCTGCGCTATTTCAATCAGATGGCCGACTGGCAGACTTTCCG
CTGGCCGGGGGAGACGTATAAACCCGGCACTCTGCTGACCTGGACCACCGTCAATGCGGGCACGCGTCTG
TTCGGTGACTACAGCGGTACCTGGGGCTTTATTCGCTGGCTGGAGCAGGGTAAACGCCATCCGCTGGATC
GCAGCCAGTGGATGATGAGCTTCTCCGCTCCGGATGGCCGCACCCTGCAGTGGGTATTGCGCTCCCAGCT
TGGGAGTGGCCCGCTGGCGCTTCTGGCGCTGCGCGGATTGACCCTGCCGGATCAGATTTTCACTGTCGAT
GCGGCTGAGAGCGCACAGGCCCTGACGACGGGGGTAGGGAATAGTGACATGGATGAGATGGAATAA
 Primer design