SecReT6
Protein ID: 288958618
SecReT6 ID378
T6SS typei5
Gene symbol-
Locus tagAZL_017770
StrainAzospirillum sp. B510
Repliconchromosome [GenBank: NC_013854] [Browse all T6SS(s) in this replicon]
Location [Strand]2028331..2029665 [-]
Producthypothetical protein
NoteTssK
UniProt IDD3NVI6
KEGG IDazl:AZL_017770
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.00E-157, Aligned region: 19..443
Protein Sequence: 444 a.a.     [Download]
>gi|288958618|ref|YP_003448959.1| hypothetical protein AZL_017770 [Azospirillum sp. B510]
MSWDDKVIWSEGMFLRAQHFQQQDRYVERLVRGRVAGLRPFAWGISELTVNRELLAVGKFAVLRCKGILE
DGTPINIPDDDDPPPPLDLPETLANSIVYLALPVRQRGGVEFEVGESADTATRYVGEEGETVDAVAGSAS
VSRIRTGRLRLRYRLERQERAGYHCLGLARIQEVRSDRRATLDERYIPPALNVQALAPLAGFVTEIQGLL
NSRAEALAARVGGSNGRGAGEMADFLMLQVANRSEPLFANIARMPDIHPERLHGMMLSLAGELATFTALN
KRPPAFPPYRHDDLQGTLEPVMAEVRRSLSAVLEQTAVPIDLQERKYGIRVGTIADRTLITTATFVLAVR
ADMPGETLRRNFPALVKIGPVEQIRELVNVQLPGIRVRPLPVAPRQLPYHAGAVYFELERGSPIWKQLAT
SGGIAVHLAGDFPQVTMELWAIRG
 
Nucleotide Sequence: 1335 bp     [Download]
>gi|288956841|ref|NC_013854.1|:c2029665-2028331 Azospirillum sp. B510 chromosome, complete genome
ATGAGTTGGGACGACAAGGTCATCTGGTCCGAAGGCATGTTCCTGCGGGCGCAGCATTTCCAGCAGCAGG
ACCGCTATGTCGAACGGCTGGTGCGCGGCCGGGTCGCCGGCCTGCGTCCCTTCGCCTGGGGCATCAGCGA
GCTGACGGTCAACCGCGAGCTTCTGGCGGTCGGCAAATTCGCCGTGCTGCGCTGCAAGGGCATCCTGGAG
GACGGGACGCCGATCAACATCCCCGACGACGACGATCCGCCGCCGCCGCTCGACCTGCCCGAAACGCTGG
CGAACAGCATCGTCTATCTGGCATTGCCGGTGCGCCAGCGCGGCGGCGTCGAGTTCGAGGTGGGCGAGAG
CGCCGACACCGCCACCCGCTATGTCGGCGAGGAGGGCGAGACGGTCGACGCCGTCGCCGGTTCGGCCAGC
GTGTCGCGCATCCGCACCGGGCGGTTGCGGCTGCGCTACCGGCTGGAGCGGCAGGAACGGGCCGGCTACC
ACTGCCTGGGCCTCGCCCGCATCCAGGAGGTGCGGTCGGACCGCCGCGCCACGCTGGACGAGCGCTACAT
CCCGCCTGCCCTCAATGTCCAGGCGCTGGCGCCGCTGGCCGGCTTCGTCACCGAAATCCAGGGACTGCTG
AACAGCCGGGCCGAAGCGCTGGCCGCCCGCGTCGGCGGGTCCAACGGGCGCGGCGCCGGCGAGATGGCCG
ACTTCCTGATGCTCCAGGTCGCCAACCGCAGCGAGCCGCTGTTCGCCAACATCGCCCGCATGCCCGACAT
CCATCCCGAACGGCTGCACGGCATGATGCTGTCGCTGGCCGGCGAACTGGCCACCTTCACCGCGCTGAAC
AAGCGTCCGCCCGCCTTCCCGCCCTATCGGCACGACGACCTCCAGGGCACGCTGGAACCGGTGATGGCGG
AGGTTCGCCGCTCGCTCAGCGCGGTGCTGGAGCAGACGGCGGTTCCCATCGATCTTCAGGAGCGCAAATA
TGGCATCCGCGTCGGCACCATCGCCGACCGCACGTTGATCACCACCGCGACCTTCGTGCTGGCGGTGCGG
GCGGACATGCCGGGCGAGACCCTGCGCCGCAACTTCCCGGCGCTGGTGAAGATCGGTCCGGTCGAACAAA
TCCGCGAACTGGTCAATGTACAGCTTCCCGGTATCCGAGTAAGGCCGCTGCCGGTCGCGCCGCGCCAGCT
GCCCTACCATGCCGGCGCCGTGTATTTCGAGCTCGAACGCGGTAGCCCGATTTGGAAACAGCTTGCAACG
TCCGGCGGAATCGCGGTTCATCTGGCAGGTGATTTCCCCCAGGTGACGATGGAGCTTTGGGCGATCCGTG
GCTGA
 Primer design