SecReT6
Protein ID: 288958619
SecReT6 ID378
T6SS typei5
Gene symbol-
Locus tagAZL_017780
StrainAzospirillum sp. B510
Repliconchromosome [GenBank: NC_013854] [Browse all T6SS(s) in this replicon]
Location [Strand]2029710..2030876 [-]
ProductFHA domain-containing protein
NoteFha
UniProt IDD3NVI7
KEGG IDazl:AZL_017780
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 6.40E-14, Aligned region: 28..96
SPO11_like [PF03533], Evalue: 0.00065, Aligned region: 349..372
Protein Sequence: 388 a.a.     [Download]
>gi|288958619|ref|YP_003448960.1| FHA domain-containing protein [Azospirillum sp. B510]
MKLRLTLVQCPPSQGGDIARDLGGGRLVIGRGPDCDWVLHDPDRTLSKTHCMVEFKGGVYVVIDSSTNGV
FLNESPTAIGRGNSAVVGEGDRLRMGGFVMRAGFAAEEAPPANDPFLAVLRGADAPARPAVAEDDPFAPP
AFGRGPVPVMPIPDDEDLFGRAGDRRSGGTSGGWQPTAAADGRDADWPGSAQPDFAPDSLGTIRVAAESP
GFGSAAGAGGMTIPEDWLDEPLDTPPFPPPAIPSVGSAHLPDDWADAPLVPPAFGNRPTPAPAADPLARA
LADVVLSLVRQQAALDSLLGLDPEETRALGDSPLLRAADGADALARLRALPPAEAEALLRSAASAAIAHQ
SALLAAVRELAGETADGGARLAALYRRLLPVHRHALGG
 
Nucleotide Sequence: 1167 bp     [Download]
>gi|288956841|ref|NC_013854.1|:c2030876-2029710 Azospirillum sp. B510 chromosome, complete genome
ATGAAGCTGCGCCTGACCCTGGTCCAATGCCCGCCGTCGCAGGGCGGCGACATCGCCCGCGACCTCGGCG
GCGGCCGGCTGGTGATCGGCCGCGGTCCCGACTGCGACTGGGTGCTGCACGACCCGGACCGCACGCTGTC
CAAGACCCACTGCATGGTGGAGTTCAAGGGCGGCGTCTATGTCGTCATCGACAGCTCGACCAACGGCGTC
TTCCTGAACGAGTCGCCGACCGCCATCGGCCGCGGCAACTCCGCGGTGGTGGGGGAGGGCGACCGGCTGC
GCATGGGCGGCTTCGTCATGCGCGCCGGCTTCGCCGCCGAGGAGGCGCCGCCCGCCAACGATCCGTTCCT
GGCGGTGCTGCGCGGCGCCGACGCGCCGGCCCGTCCGGCCGTGGCGGAGGACGACCCCTTCGCCCCGCCG
GCCTTCGGCCGCGGTCCGGTGCCGGTGATGCCGATCCCGGACGACGAGGATCTGTTCGGCCGGGCCGGCG
ACCGCAGGAGCGGCGGAACGTCGGGCGGCTGGCAGCCCACCGCTGCCGCCGATGGACGCGATGCCGACTG
GCCCGGCTCGGCGCAGCCCGACTTCGCCCCCGACAGTCTCGGCACCATCCGGGTGGCGGCGGAGTCGCCC
GGCTTCGGCTCCGCCGCCGGTGCCGGCGGCATGACGATTCCCGAGGATTGGCTGGACGAGCCGCTCGACA
CGCCGCCCTTTCCGCCGCCAGCGATCCCGTCGGTGGGCTCCGCCCATTTGCCCGACGACTGGGCGGACGC
GCCGCTGGTGCCGCCGGCCTTCGGCAACCGTCCGACACCGGCCCCGGCCGCCGACCCGTTGGCGCGGGCG
CTGGCCGACGTGGTGCTGTCGCTGGTCCGCCAGCAGGCGGCGCTGGACTCCCTGCTCGGCCTTGATCCGG
AGGAGACGCGTGCTCTGGGCGACTCCCCGCTGCTGCGGGCCGCCGATGGCGCCGACGCGCTGGCCCGTCT
GCGCGCCCTGCCGCCGGCCGAGGCCGAGGCGCTGCTCCGCTCCGCCGCGTCCGCCGCCATCGCCCACCAG
TCGGCGCTGCTGGCGGCGGTGCGCGAGCTGGCCGGGGAGACCGCCGATGGCGGTGCGCGGCTGGCCGCGC
TCTACCGTCGGCTTCTGCCGGTCCACCGCCATGCGCTCGGCGGCTGA
 Primer design