SecReT6
Protein ID: 288958621
SecReT6 ID378
T6SS typei5
Gene symbol-
Locus tagAZL_017800
StrainAzospirillum sp. B510
Repliconchromosome [GenBank: NC_013854] [Browse all T6SS(s) in this replicon]
Location [Strand]2031526..2033646 [-]
Producthypothetical protein
NoteTssI
UniProt IDD3NVI9
KEGG IDazl:AZL_017800
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 4.50E-68, Aligned region: 33..333
Phage_base_V [PF04717], Evalue: 9.20E-24, Aligned region: 373..465
Gp5_C [PF06715], Evalue: 2.30E-08, Aligned region: 513..530
Gp5_C [PF06715], Evalue: 2.30E-08, Aligned region: 524..548
Gp5_C [PF06715], Evalue: 2.30E-08, Aligned region: 559..584
Gp5_C [PF06715], Evalue: 2.30E-08, Aligned region: 577..602
Gp5_C [PF06715], Evalue: 2.30E-08, Aligned region: 586..610
Gp5_C [PF06715], Evalue: 2.30E-08, Aligned region: 604..620
Gp5_C [PF06715], Evalue: 2.30E-08, Aligned region: 673..689
Gp5_C [PF06715], Evalue: 2.30E-08, Aligned region: 691..700
DUF2345 [PF10106], Evalue: 0.0013, Aligned region: 499..560
DUF2345 [PF10106], Evalue: 0.0013, Aligned region: 552..685
Protein Sequence: 706 a.a.     [Download]
>gi|288958621|ref|YP_003448962.1| hypothetical protein AZL_017800 [Azospirillum sp. B510]
MSDAPTLSQTGRLLSLTSPLGADVLIPVAVEGEEGLSRLFRYTITLVSPRMTIAPADMLGKSLTLSIARK
GGDPRVVNGIVSGFSAGPLALRGHRQYTVEIVPSLWLATLRSDCRVFQEKSVVQIVDAVLSDCGVTEVRR
QGLSGTHNARPVCVQYRETHYDFIARLLRDEGIYFYFQHEAGKHTLILSDSASGYTDCLDKEVVHAASAQ
GSMLAIEGWSHAQSYVSGKWTLTDYNFETPGADLTASTATVLGVSAFKPHERFDHHAGHMVKADGTDLSR
LRMEETETGYERVEASATYRGLFAGGKISLTAHAVAAEVGKGYVLTDLALSAHDESHLGNAGGTPGFSCR
FTAIPDATVFRPPPVPRPRTHGPDTATVVGPSGEEIYCDKYGRVRVQFHWDRKGANDEKSFVWLRVAQAM
AGRNWGTLFTPRVGMEVLVDYIGGDPDRPLIVGCVYNGENMPPYTLPDNKTQSGIKTRSSKGGDATAFNE
LRFEDKKDAEEIYVHAQKDFKRVVENDDSLQVDHDQTITIKNDRTETVSEGNETITISKGKRSVTVSEGD
DSHEVSKGNQSLTVGQGDRSVTVSQGDDTHTVGQGNRTVKVGQGNDSLTVGQGNMLIDVKNGDYALKLGL
GDVSVKAGTGKITLEATTAIELKVGANSVKIDQSGVTIKGTMVKVTGDAQVQIKGAMTQLNGDGMVQVKG
GVVTIN
 
Nucleotide Sequence: 2121 bp     [Download]
>gi|288956841|ref|NC_013854.1|:c2033646-2031526 Azospirillum sp. B510 chromosome, complete genome
ATGTCGGATGCGCCCACCCTCTCGCAGACCGGCCGGCTTCTGTCGCTGACCTCGCCGCTCGGCGCGGACG
TGCTGATCCCGGTGGCCGTCGAGGGGGAGGAGGGGCTGTCGCGCCTGTTCCGCTACACCATCACACTGGT
CTCCCCACGGATGACCATCGCCCCGGCCGACATGCTGGGCAAGTCGCTGACCTTGTCCATCGCCCGCAAG
GGCGGCGATCCGCGTGTCGTCAACGGCATCGTCAGCGGCTTTTCCGCCGGGCCGCTGGCCCTGCGCGGCC
ACCGCCAATACACGGTGGAGATCGTTCCGAGCCTGTGGCTGGCCACCCTGCGCTCCGACTGCCGGGTCTT
CCAGGAGAAGAGCGTCGTCCAGATCGTCGATGCCGTCCTGTCCGACTGCGGCGTGACCGAGGTGAGGAGG
CAGGGCCTGTCCGGCACCCACAACGCCCGGCCGGTCTGCGTCCAGTACCGCGAGACCCATTACGACTTCA
TCGCCCGCCTGCTGCGGGACGAGGGCATCTATTTCTATTTCCAGCACGAGGCCGGCAAGCATACGCTGAT
CCTGAGCGACAGCGCGTCGGGCTACACCGATTGCCTGGACAAGGAGGTCGTCCATGCCGCCTCGGCCCAG
GGCAGCATGCTGGCGATCGAGGGCTGGTCGCACGCGCAATCCTACGTGTCCGGCAAATGGACGTTGACGG
ACTATAATTTCGAAACCCCCGGCGCCGACCTGACCGCCAGCACCGCCACCGTGCTGGGGGTGTCCGCCTT
CAAGCCGCACGAACGGTTCGACCATCATGCCGGCCATATGGTCAAGGCCGACGGCACCGATCTGTCCCGT
CTGCGCATGGAGGAGACGGAGACCGGCTATGAGCGGGTGGAGGCGTCGGCGACCTATCGCGGCCTGTTCG
CCGGCGGCAAGATATCCCTGACCGCCCATGCCGTGGCGGCGGAGGTCGGCAAGGGTTATGTCCTGACCGA
CCTGGCGCTGAGCGCCCATGACGAGAGCCATCTCGGCAATGCCGGCGGCACGCCCGGCTTCTCCTGCCGT
TTCACCGCGATTCCCGACGCCACGGTGTTCCGCCCGCCGCCGGTGCCGCGCCCGCGCACCCATGGGCCGG
ACACCGCGACTGTGGTCGGCCCCAGCGGCGAGGAGATCTATTGCGACAAGTATGGCCGGGTCCGGGTGCA
GTTCCATTGGGACCGCAAGGGCGCCAATGACGAGAAGAGCTTCGTCTGGCTGCGCGTCGCCCAGGCCATG
GCCGGCAGGAACTGGGGCACCCTGTTCACCCCGCGCGTCGGCATGGAGGTGCTGGTCGACTATATCGGCG
GCGACCCCGACCGGCCGCTGATCGTCGGCTGCGTCTATAACGGCGAGAACATGCCGCCCTACACGCTGCC
CGACAACAAGACGCAGAGCGGCATCAAGACCCGCTCCAGCAAGGGCGGCGACGCGACGGCCTTCAACGAG
CTGCGCTTCGAGGACAAGAAGGACGCCGAGGAGATCTATGTCCACGCTCAGAAGGACTTCAAGCGGGTGG
TGGAGAATGACGACAGCCTCCAGGTCGATCACGACCAGACCATCACCATCAAGAACGACCGCACCGAAAC
GGTGTCGGAAGGCAACGAGACGATCACGATATCCAAAGGCAAACGCAGCGTCACCGTGTCGGAGGGCGAC
GACAGCCACGAGGTCAGCAAGGGGAACCAGTCGCTGACGGTCGGGCAGGGCGACCGCAGCGTCACCGTCA
GCCAGGGCGACGACACCCACACCGTCGGCCAGGGCAACCGGACGGTGAAGGTCGGGCAGGGCAACGACAG
CCTGACCGTCGGACAGGGCAACATGCTGATCGACGTGAAGAACGGCGATTATGCGCTGAAGCTCGGCCTC
GGCGACGTGTCGGTGAAGGCCGGCACCGGCAAGATCACCCTGGAGGCCACCACCGCCATCGAGTTGAAGG
TCGGCGCCAACAGCGTCAAGATCGATCAGAGCGGCGTCACCATCAAGGGCACCATGGTCAAGGTCACCGG
CGACGCCCAGGTCCAGATCAAGGGCGCGATGACCCAGCTGAACGGCGATGGGATGGTCCAGGTCAAGGGC
GGCGTGGTAACCATCAATTGA
 Primer design