SecReT6
Protein ID: 288958622
SecReT6 ID378
T6SS typei5
Gene symbol-
Locus tagAZL_017810
StrainAzospirillum sp. B510
Repliconchromosome [GenBank: NC_013854] [Browse all T6SS(s) in this replicon]
Location [Strand]2033769..2034245 [-]
Producthypothetical protein
NoteTssD
UniProt IDD3NVJ0
KEGG IDazl:AZL_017810
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 3.30E-31, Aligned region: 4..133
Protein Sequence: 158 a.a.     [Download]
>gi|288958622|ref|YP_003448963.1| hypothetical protein AZL_017810 [Azospirillum sp. B510]
MAIYVKYDGIDGEATHESHKKWLDVGSLQWGVGRAISTPSGSTANREASEPSVSEVTISKMMDSSSPKFF
VESCTGAIGKKVQIHLVTTGNPGNTYAEYTLTNALVSSYSMSSGGDRPSESISISFTKMEYKFIPYDDKN
KAGTPISVSYDLSTTKSA
 
Nucleotide Sequence: 477 bp     [Download]
>gi|288956841|ref|NC_013854.1|:c2034245-2033769 Azospirillum sp. B510 chromosome, complete genome
ATGGCGATCTATGTAAAGTATGACGGCATCGACGGTGAGGCGACGCACGAGTCCCACAAGAAGTGGCTCG
ACGTCGGTTCGCTCCAGTGGGGCGTCGGCCGCGCCATCAGCACCCCGTCGGGCTCGACCGCCAACCGCGA
GGCGTCGGAGCCGTCGGTGTCGGAAGTGACCATCAGCAAGATGATGGACAGCTCCTCGCCGAAGTTCTTC
GTCGAGTCCTGCACCGGCGCCATCGGCAAGAAGGTGCAGATCCACCTCGTCACCACCGGCAACCCGGGCA
ACACCTACGCCGAATACACCCTGACCAACGCCCTGGTCTCGTCCTATTCGATGTCGTCCGGCGGTGACCG
TCCGTCGGAGTCGATCTCCATCAGCTTCACCAAGATGGAGTACAAGTTCATCCCCTACGACGACAAGAAC
AAGGCCGGCACGCCGATCTCGGTCTCCTACGACCTGTCGACGACCAAGAGCGCCTGA
 Primer design