SecReT6
Protein ID: 288958623
SecReT6 ID378
T6SS typei5
Gene symbol-
Locus tagAZL_017820
StrainAzospirillum sp. B510
Repliconchromosome [GenBank: NC_013854] [Browse all T6SS(s) in this replicon]
Location [Strand]2034416..2037103 [-]
Productchaperone protein
NoteTssH
UniProt IDD3NVJ1
KEGG IDazl:AZL_017820
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.70E-40, Aligned region: 293..308
AAA_2 [PF07724], Evalue: 1.70E-40, Aligned region: 626..793
AAA_2 [PF07724], Evalue: 1.70E-40, Aligned region: 848..867
AAA [PF00004], Evalue: 1.70E-16, Aligned region: 232..364
AAA [PF00004], Evalue: 1.70E-16, Aligned region: 632..755
AAA_5 [PF07728], Evalue: 1.00E-13, Aligned region: 232..251
AAA_5 [PF07728], Evalue: 1.00E-13, Aligned region: 306..362
AAA_5 [PF07728], Evalue: 1.00E-13, Aligned region: 631..750
ClpB_D2-small [PF10431], Evalue: 1.80E-13, Aligned region: 799..871
AAA_16 [PF13191], Evalue: 1.60E-10, Aligned region: 91..105
AAA_16 [PF13191], Evalue: 1.60E-10, Aligned region: 209..252
AAA_16 [PF13191], Evalue: 1.60E-10, Aligned region: 277..310
AAA_16 [PF13191], Evalue: 1.60E-10, Aligned region: 516..516
AAA_16 [PF13191], Evalue: 1.60E-10, Aligned region: 601..652
AAA_16 [PF13191], Evalue: 1.60E-10, Aligned region: 696..724
Sigma54_activat [PF00158], Evalue: 2.20E-06, Aligned region: 216..246
Sigma54_activat [PF00158], Evalue: 2.20E-06, Aligned region: 631..749
AAA_22 [PF13401], Evalue: 9.50E-06, Aligned region: 231..318
AAA_22 [PF13401], Evalue: 9.50E-06, Aligned region: 349..403
AAA_22 [PF13401], Evalue: 9.50E-06, Aligned region: 629..665
Zeta_toxin [PF06414], Evalue: 8.20E-05, Aligned region: 131..153
Zeta_toxin [PF06414], Evalue: 8.20E-05, Aligned region: 227..252
Zeta_toxin [PF06414], Evalue: 8.20E-05, Aligned region: 616..671
NACHT [PF05729], Evalue: 0.00034, Aligned region: 232..260
NACHT [PF05729], Evalue: 0.00034, Aligned region: 631..658
Arch_ATPase [PF01637], Evalue: 0.0019, Aligned region: 211..248
Arch_ATPase [PF01637], Evalue: 0.0019, Aligned region: 285..316
Arch_ATPase [PF01637], Evalue: 0.0019, Aligned region: 630..671
AAA_25 [PF13481], Evalue: 0.002, Aligned region: 232..270
AAA_25 [PF13481], Evalue: 0.002, Aligned region: 629..653
AAA_25 [PF13481], Evalue: 0.002, Aligned region: 693..715
Clp_N [PF02861], Evalue: 0.0031, Aligned region: 37..75
Clp_N [PF02861], Evalue: 0.0031, Aligned region: 106..130
AAA_17 [PF13207], Evalue: 0.0099, Aligned region: 232..281
AAA_17 [PF13207], Evalue: 0.0099, Aligned region: 631..666
Protein Sequence: 895 a.a.     [Download]
>gi|288958623|ref|YP_003448964.1| chaperone protein [Azospirillum sp. B510]
MVSVDLQGLISRLHPVCRRSLEAAAGQTLSRTHYNCEIEHWLLQLIGAADGDVCAILRVYEIDAGRLSAD
LTRVLDKLKTGNSRAPALSPALVQLMREAWVLASLQYGEGAIRSGHLLAALLSDDSLSAQARDMSGQFAR
ISAEALRRDLPGIVADTAEARTGAAAAAAAAGGGGAAGGAAKAGGATPNLDQYTIDLTERAKAGGIDPVL
GRDAEIRQIIDVLTRRRQNNPILTGEAGVGKTAVVEGFALRIAAGDVPPDLRNVRLLSLDLGLLQAGAGM
KGEFENRLKGVIDEVKGSSQPIILFIDEAHTLIGAGGQAGQNDAANLLKPALARGEMRTVAATTWAEYKK
YFEKDPALTRRFQVVKVEEPAEPVAVDMMRGLTATLEKHHKVRIVTEGLIEAVRLSSRYIPARQLPDKAV
SLLDTACARVAMSQTATPPAIEDRRRTIQLTGTELAILEREQAIGIDHAEQVAALKDRIAATEADLAALE
ARWTRELELVKAINGTRDQLVAAHERAKARGAEGAATAEPPDAEALAARLSALTAELSAVQGEDPLVKVA
VDGQAVAEVVANWTGVPVGRMVSNEIRTILSLADRMKERIIGQDHALDAIAQAMWTSRAKLTDPRKPIGV
FLMVGTSGVGKTETALTLAELIYGGEQNVTTINMTEYKEEHKVSLLLGSPPGYVGFGEGGVLTEAVRRRP
YSVVLLDELEKAHPGVQDIFFQLFDKGTIKDGEGRDIDFKNTVIIMTSNAGTDLIHKLCADPETAPDADG
LLEALHPELQKSFKPAFLGRCTVIPYFQLSDENLKKIVVLQLNRIARRVARNYKAAFSYSDDLVQGIVDR
CREVSSGARNIETILNRTLLPEMSSRILARMGDGEPITRVHVAVDGEDRFIYDIA
 
Nucleotide Sequence: 2688 bp     [Download]
>gi|288956841|ref|NC_013854.1|:c2037103-2034416 Azospirillum sp. B510 chromosome, complete genome
ATGGTGTCTGTCGATCTTCAGGGCCTGATTTCGCGTCTGCATCCGGTTTGCCGGCGGTCTCTGGAGGCTG
CTGCGGGTCAGACGCTGTCGCGCACGCATTACAATTGCGAGATCGAGCACTGGCTTCTCCAGCTGATCGG
CGCCGCCGACGGTGACGTTTGCGCCATCCTGCGTGTCTACGAGATCGACGCCGGGCGTCTGTCGGCCGAC
CTGACGCGGGTTCTGGACAAGCTGAAGACCGGCAACAGCCGGGCGCCGGCCCTTTCGCCCGCCCTCGTCC
AGCTGATGCGCGAGGCCTGGGTCCTGGCCTCCCTGCAATATGGCGAGGGGGCGATCCGCTCCGGCCATCT
GCTGGCCGCGCTGCTGTCGGACGACTCGCTGTCGGCCCAGGCCCGCGACATGTCGGGCCAGTTCGCCAGG
ATCAGCGCCGAGGCGCTGCGCCGCGACCTGCCCGGGATCGTCGCCGACACGGCGGAGGCGCGGACCGGCG
CCGCGGCCGCCGCGGCCGCGGCCGGAGGCGGTGGCGCCGCGGGCGGTGCCGCGAAGGCCGGCGGGGCGAC
CCCCAACCTCGACCAGTACACCATCGACCTGACCGAGCGGGCGAAGGCCGGCGGGATCGACCCGGTGCTC
GGCCGCGACGCCGAGATCCGCCAGATCATCGACGTGCTGACCCGCCGCCGCCAGAACAACCCGATCCTGA
CCGGCGAGGCCGGCGTCGGCAAGACGGCGGTGGTGGAGGGCTTCGCGCTGCGCATCGCCGCGGGCGACGT
GCCGCCCGACCTGCGCAACGTCCGCCTGCTGTCGCTCGACCTCGGGCTGCTCCAGGCCGGCGCCGGCATG
AAGGGCGAGTTCGAGAACCGGCTGAAGGGCGTGATCGACGAGGTGAAGGGGTCGAGCCAGCCGATCATCC
TGTTCATCGACGAGGCGCACACCCTGATCGGCGCCGGCGGGCAGGCCGGGCAGAACGACGCCGCCAACCT
GCTGAAGCCGGCGCTGGCGCGTGGCGAGATGCGCACCGTCGCCGCCACCACCTGGGCCGAGTACAAGAAA
TATTTCGAGAAGGACCCGGCGCTGACCCGCCGCTTCCAGGTGGTGAAGGTGGAGGAGCCGGCGGAGCCGG
TCGCCGTCGACATGATGCGGGGCCTGACCGCGACGCTGGAGAAGCACCACAAGGTCCGCATCGTGACCGA
GGGGCTGATCGAAGCGGTCCGGCTGTCGAGCCGCTACATCCCGGCGCGCCAGCTTCCCGACAAGGCGGTC
AGCCTGCTCGACACCGCCTGCGCCCGCGTGGCGATGAGCCAGACCGCCACCCCGCCGGCCATCGAGGACC
GCCGCCGCACCATCCAGCTGACCGGGACCGAGCTGGCGATCCTGGAGCGCGAGCAGGCCATCGGCATCGA
CCATGCCGAGCAGGTGGCGGCGCTGAAGGACAGGATCGCCGCCACCGAGGCCGATCTGGCGGCGCTGGAG
GCGCGCTGGACCAGGGAGCTGGAGCTGGTCAAGGCGATCAACGGCACGCGCGATCAGCTGGTCGCCGCGC
ACGAGCGGGCGAAGGCGCGGGGCGCCGAGGGCGCCGCCACGGCCGAACCGCCTGACGCCGAAGCGCTGGC
CGCCCGGCTTTCGGCGCTGACCGCCGAGCTTTCGGCGGTGCAGGGCGAGGATCCGCTGGTCAAGGTGGCG
GTGGACGGGCAGGCGGTGGCCGAGGTGGTCGCCAACTGGACCGGCGTCCCGGTCGGCCGCATGGTGTCGA
ACGAGATCAGGACCATCCTGTCGCTGGCCGACCGCATGAAGGAGCGGATCATCGGCCAGGACCATGCGCT
GGACGCCATCGCCCAGGCGATGTGGACCAGCCGGGCCAAGCTGACCGACCCGCGCAAGCCGATCGGCGTC
TTCCTGATGGTCGGCACGTCCGGCGTCGGCAAGACCGAGACGGCGCTGACGCTGGCCGAGCTGATCTATG
GCGGCGAGCAGAACGTCACCACCATCAACATGACCGAATACAAGGAGGAGCATAAGGTCTCGCTTCTGCT
GGGCTCTCCTCCCGGCTATGTCGGCTTCGGCGAGGGCGGCGTGCTGACCGAGGCGGTGCGGCGCCGGCCC
TACAGCGTCGTGCTGCTGGACGAGCTGGAGAAGGCCCATCCCGGCGTGCAGGACATCTTCTTCCAGCTGT
TCGACAAGGGCACGATCAAGGACGGCGAAGGCCGCGACATCGACTTCAAGAACACCGTCATCATCATGAC
GTCGAACGCCGGCACCGACCTGATCCACAAGCTGTGCGCCGACCCGGAGACCGCGCCGGACGCCGACGGG
CTGCTGGAGGCGCTGCATCCGGAGTTGCAGAAGAGCTTCAAGCCGGCCTTTCTCGGCCGCTGCACCGTCA
TTCCCTATTTCCAGCTGTCCGACGAGAATCTGAAGAAGATCGTCGTGCTGCAACTGAACCGCATCGCCCG
GCGGGTGGCGCGGAATTACAAGGCGGCCTTCTCCTATTCCGACGATCTGGTCCAGGGCATCGTCGACCGT
TGCCGGGAGGTCTCCAGCGGCGCCCGCAACATCGAGACCATCCTGAACCGCACGCTTCTGCCGGAGATGT
CGTCGCGCATCCTCGCCCGCATGGGCGACGGCGAGCCGATCACCCGCGTCCATGTCGCCGTCGATGGCGA
GGACCGCTTCATCTACGACATCGCCTGA
 Primer design