SecReT6
Protein ID: 288958625
SecReT6 ID378
T6SS typei5
Gene symbol-
Locus tagAZL_017840
StrainAzospirillum sp. B510
Repliconchromosome [GenBank: NC_013854] [Browse all T6SS(s) in this replicon]
Location [Strand]2038366..2038749 [-]
Producthypothetical protein
NotePAAR
UniProt IDD3NVJ3
KEGG IDazl:AZL_017840
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 4.10E-24, Aligned region: 3..11
PAAR_motif [PF05488], Evalue: 4.10E-24, Aligned region: 10..119
DUF4150 [PF13665], Evalue: 8.90E-06, Aligned region: 18..31
DUF4150 [PF13665], Evalue: 8.90E-06, Aligned region: 42..62
DUF4150 [PF13665], Evalue: 8.90E-06, Aligned region: 74..106
Protein Sequence: 127 a.a.     [Download]
>gi|288958625|ref|YP_003448966.1| hypothetical protein AZL_017840 [Azospirillum sp. B510]
MPPAARLGDLIKQDAPHCHAPIHPPAPVPAPAPHPGLPLAIVLGSPTVLIGKAPAARLTDISAPCMLPGC
VPAGPGMISQGSGTVLINNLPAARINDMTAHTSCVAPIPSPVGKVLPPGCPTVIIGG
 
Nucleotide Sequence: 384 bp     [Download]
>gi|288956841|ref|NC_013854.1|:c2038749-2038366 Azospirillum sp. B510 chromosome, complete genome
ATGCCGCCCGCCGCCCGCCTCGGCGATCTCATCAAGCAGGACGCGCCGCATTGCCATGCGCCGATCCACC
CGCCGGCCCCGGTGCCGGCGCCGGCGCCCCATCCGGGCCTGCCGCTGGCCATCGTGCTGGGCAGCCCGAC
GGTACTGATCGGCAAGGCGCCGGCGGCGCGGCTGACCGACATCTCGGCGCCCTGCATGCTGCCCGGCTGC
GTCCCGGCCGGTCCCGGCATGATTTCCCAGGGGTCGGGAACCGTGCTGATCAACAATCTGCCGGCGGCGC
GGATCAACGACATGACCGCGCACACCAGCTGCGTCGCCCCCATCCCGTCACCGGTCGGCAAGGTGCTGCC
GCCCGGCTGCCCCACCGTCATCATCGGCGGCTGA
 Primer design