SecReT6
Protein ID: 288958627
SecReT6 ID378
T6SS typei5
Gene symbol-
Locus tagAZL_017860
StrainAzospirillum sp. B510
Repliconchromosome [GenBank: NC_013854] [Browse all T6SS(s) in this replicon]
Location [Strand]2039317..2040450 [+]
ProductimpA-related N-terminal protein
NoteTssA
UniProt IDD3NVJ5
KEGG IDazl:AZL_017860
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 9.50E-22, Aligned region: 64..124
Protein Sequence: 377 a.a.     [Download]
>gi|288958627|ref|YP_003448968.1| impA-related N-terminal protein [Azospirillum sp. B510]
MPTPQIFDIEDLLQPLDGESESGIDLRENASADYYTVKDARSAARAAERSMDVEDDAGGLLPEWRVILEV
CPRILRTQAKDLEVTAWFIEALLRAEGYAGLRDGFALARGLVERFWDGLYPAPDEDGIATRVGPLTGLNG
ESADGTLIQPIRKVPLTGGDVAYSLWQYEQAVELAKITDEARRQTRIDNGAVTWDQFEQSVRETPASAFG
TLVGDIQGAIDEFEALGKALYDKAGYDAPPAGNIRSVLTAALDAVNYAARDRLATLAGDEPAAMDSAPET
AEAAAAGGSVPATAKIQASGAVTNREDAFKVLLQVADFFRKTEPHSPISYTLEEVVRRGRMSLQELLQEL
ITDEETRRQFFIASGAKAPPPAEQSGY
 
Nucleotide Sequence: 1134 bp     [Download]
>gi|288956841|ref|NC_013854.1|:2039317-2040450 Azospirillum sp. B510 chromosome, complete genome
ATGCCGACACCGCAGATTTTCGATATTGAAGACCTGCTGCAACCGCTCGATGGCGAGTCCGAATCCGGGA
TCGATCTGCGCGAGAACGCATCGGCCGACTATTATACGGTGAAGGATGCCCGCAGCGCCGCCCGTGCCGC
CGAACGATCCATGGATGTGGAGGATGACGCCGGCGGGCTTCTGCCGGAATGGCGCGTCATCCTGGAGGTC
TGCCCGCGTATCCTGCGCACCCAGGCGAAGGATCTGGAGGTCACCGCCTGGTTCATCGAGGCGCTGCTGC
GGGCGGAGGGATATGCCGGCCTGCGCGACGGCTTCGCCCTGGCGCGCGGCCTGGTCGAGCGCTTCTGGGA
CGGGCTCTATCCGGCACCGGACGAGGATGGCATCGCCACCCGCGTCGGCCCGCTGACCGGCCTGAACGGC
GAATCCGCCGACGGCACGCTGATCCAGCCGATCCGCAAGGTGCCGCTGACCGGCGGCGACGTCGCCTATT
CGCTGTGGCAGTACGAACAGGCGGTGGAACTGGCGAAGATCACCGACGAGGCGCGCCGGCAGACCCGCAT
CGACAACGGCGCCGTCACCTGGGACCAGTTCGAGCAGAGCGTGCGGGAAACCCCGGCGTCCGCGTTCGGG
ACGCTGGTCGGGGACATCCAGGGCGCCATCGACGAATTCGAGGCGCTGGGCAAGGCGCTGTACGACAAGG
CCGGCTACGACGCGCCGCCCGCCGGCAACATCCGCTCCGTGCTGACCGCCGCGCTCGACGCGGTGAATTA
CGCCGCGCGCGACCGTCTGGCCACCCTGGCCGGCGACGAGCCGGCGGCGATGGACAGCGCGCCGGAGACG
GCGGAAGCGGCGGCGGCCGGCGGTTCCGTGCCGGCCACGGCGAAAATCCAGGCCAGCGGCGCCGTGACCA
ACCGCGAGGACGCCTTCAAGGTTCTCTTGCAGGTCGCCGATTTCTTCCGCAAGACGGAACCCCATTCGCC
CATCTCCTACACCTTGGAGGAGGTGGTGCGCCGCGGCCGCATGTCGTTGCAGGAGCTTTTGCAGGAACTG
ATCACCGACGAGGAGACGCGGAGGCAGTTCTTCATCGCGTCGGGCGCCAAGGCGCCGCCGCCGGCCGAAC
AATCCGGGTATTGA
 Primer design