SecReT6
Protein ID: 288958628
SecReT6 ID378
T6SS typei5
Gene symbol-
Locus tagAZL_017870
StrainAzospirillum sp. B510
Repliconchromosome [GenBank: NC_013854] [Browse all T6SS(s) in this replicon]
Location [Strand]2040495..2041001 [+]
Producthypothetical protein
NoteTssB
UniProt IDD3NVJ6
KEGG IDazl:AZL_017870
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.30E-62, Aligned region: 8..163
Protein Sequence: 168 a.a.     [Download]
>gi|288958628|ref|YP_003448969.1| hypothetical protein AZL_017870 [Azospirillum sp. B510]
MASIHQKLDRVRKPRVHITYDVETEGATVVKELPFVVGVLGDFSGDPTEPLKPLKDRKFIQIDRDNFNDV
MARMTPGLKMKVENTLADDGTEMAVDLSFKSMEDFEPGRVVQQVEPLRKLLETRNQLRDLLSKADRSEEL
EGLLERVLQNTDELKALSGELGNETKEG
 
Nucleotide Sequence: 507 bp     [Download]
>gi|288956841|ref|NC_013854.1|:2040495-2041001 Azospirillum sp. B510 chromosome, complete genome
ATGGCAAGTATCCACCAGAAGCTGGATCGCGTGCGCAAACCCCGCGTCCACATCACCTACGACGTCGAGA
CCGAAGGCGCGACCGTCGTCAAGGAGCTGCCCTTCGTCGTCGGCGTGCTCGGCGATTTCTCGGGTGATCC
GACCGAACCGCTGAAGCCGCTGAAGGACCGCAAGTTCATCCAGATCGACCGCGACAACTTCAACGACGTC
ATGGCCCGCATGACGCCGGGCCTGAAGATGAAGGTCGAGAACACGCTGGCCGACGACGGCACCGAGATGG
CCGTCGACCTCTCCTTCAAGTCGATGGAGGATTTCGAGCCGGGCCGCGTCGTCCAGCAGGTCGAGCCGCT
GCGCAAGCTGCTGGAGACCCGCAACCAGCTGCGCGACCTGCTGAGCAAGGCCGACCGCTCGGAAGAGCTG
GAAGGGCTGCTGGAGCGCGTGCTGCAAAACACCGACGAGCTGAAGGCGCTGAGCGGCGAGCTTGGCAACG
AGACCAAGGAGGGTTGA
 Primer design