SecReT6
Protein ID: 288958629
SecReT6 ID378
T6SS typei5
Gene symbol-
Locus tagAZL_017880
StrainAzospirillum sp. B510
Repliconchromosome [GenBank: NC_013854] [Browse all T6SS(s) in this replicon]
Location [Strand]2041006..2042499 [+]
Producthypothetical protein
NoteTssC
UniProt IDD3NVJ7
KEGG IDazl:AZL_017880
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.70E-195, Aligned region: 65..494
Protein Sequence: 497 a.a.     [Download]
>gi|288958629|ref|YP_003448970.1| hypothetical protein AZL_017880 [Azospirillum sp. B510]
MSDAQTQGATAAGAAAEGTGLSILDQAIAATKQTEPDRAQELLRTLTQEALAGTVTFNKNLGQTISKAIA
EIDAKISKQLNAIMHHEKFQKLEGSWRGLNYLVMNSETGSTLKIRVMNCPKKDLYKDISKAVEFDQSNLF
KKIYENEFGIAGGEPYGALIGDYEFTSHPEDVELLSGVSNVAAAAFAPFISAASPKLFGFEDMTELSKPR
DLEKIFDSVEYAKWRSFRESDDSRFVTLTMPRVLARLPYGASTKPIEEFEYEEAPFDGGVARPMRHGDYC
WMNAAYAMGERLTSAFSQYGWCTAIRGAEGGGKVENLPFHTFTSDDGDSDAKCPTEIGITDRREAELSKL
GFLPLCHYKNQDYAVFFGAQTTQKAKKYDRPEATANAAISARLPYIMATSRFAHYLKIMARDKIGSFMEA
SDCEAWLNRWILNYVNGNADAGQEMKAKYPLAEAKVQVKEIPGKPGSYNAVAWMRPWLQMEELTTSMRMV
ARIPQAG
 
Nucleotide Sequence: 1494 bp     [Download]
>gi|288956841|ref|NC_013854.1|:2041006-2042499 Azospirillum sp. B510 chromosome, complete genome
ATGAGCGACGCACAGACCCAGGGCGCCACCGCCGCCGGCGCCGCCGCCGAGGGCACCGGCCTGTCGATCC
TCGATCAGGCCATCGCCGCGACCAAGCAGACCGAGCCGGACCGCGCGCAGGAGCTGTTGCGCACCCTGAC
CCAGGAAGCGCTGGCCGGCACGGTCACCTTCAACAAGAATCTGGGCCAGACGATCAGCAAGGCGATCGCC
GAGATCGACGCGAAGATCAGCAAGCAGCTGAACGCGATCATGCACCACGAGAAGTTCCAGAAGCTGGAAG
GTTCGTGGCGCGGCCTGAATTATCTGGTCATGAACTCGGAAACGGGCTCCACGCTCAAGATCCGCGTCAT
GAACTGCCCGAAGAAGGACCTGTACAAGGACATCTCCAAGGCGGTCGAGTTCGACCAGAGCAACCTGTTC
AAGAAGATCTACGAGAACGAGTTCGGCATCGCCGGCGGCGAACCCTATGGCGCGCTGATCGGCGATTACG
AGTTCACCAGCCACCCCGAGGATGTCGAGCTGCTGAGCGGCGTGTCGAACGTCGCAGCCGCCGCCTTCGC
GCCCTTCATCTCCGCCGCCAGCCCCAAGCTGTTCGGCTTCGAGGACATGACCGAGCTGTCGAAGCCACGC
GACCTGGAGAAGATCTTCGACAGCGTCGAATACGCCAAGTGGCGCAGCTTCCGTGAAAGCGACGACAGCC
GCTTCGTCACGTTGACCATGCCGCGCGTGCTGGCCCGCCTGCCCTATGGCGCCAGCACCAAGCCGATCGA
GGAGTTCGAGTATGAGGAGGCGCCGTTCGATGGCGGCGTCGCCCGTCCGATGCGGCACGGCGACTATTGC
TGGATGAACGCCGCCTACGCGATGGGCGAGCGCCTGACCAGCGCCTTCTCGCAATATGGCTGGTGCACCG
CCATCCGCGGCGCCGAGGGCGGCGGCAAGGTCGAGAATCTGCCCTTCCACACCTTCACCTCGGACGACGG
CGACAGCGACGCCAAGTGCCCGACCGAGATCGGCATCACCGACCGCCGCGAGGCTGAGCTGTCGAAACTG
GGCTTCCTGCCGCTCTGCCATTACAAGAACCAGGACTACGCCGTCTTCTTCGGCGCCCAGACCACCCAGA
AGGCCAAGAAGTACGACCGGCCGGAGGCGACCGCCAACGCCGCGATCTCCGCCCGCCTGCCCTACATCAT
GGCGACCTCGCGTTTCGCCCATTACCTGAAGATCATGGCGCGCGACAAGATCGGCTCCTTCATGGAGGCG
AGCGACTGCGAGGCGTGGCTGAACCGCTGGATCCTGAACTACGTCAACGGCAACGCCGACGCCGGCCAGG
AGATGAAGGCGAAGTACCCGCTGGCCGAGGCCAAGGTGCAGGTGAAGGAGATTCCGGGCAAGCCCGGTTC
CTACAACGCCGTCGCCTGGATGCGCCCGTGGCTGCAGATGGAGGAGCTGACCACCTCCATGCGCATGGTC
GCCCGCATCCCGCAGGCCGGCTGA
 Primer design

Protein ID: 288958630
SecReT6 ID378
T6SS typei5
Gene symbol-
Locus tagAZL_017890
StrainAzospirillum sp. B510
Repliconchromosome [GenBank: NC_013854] [Browse all T6SS(s) in this replicon]
Location [Strand]2042521..2044077 [+]
Producthypothetical protein
NoteTssC
UniProt IDD3NVJ8
KEGG IDazl:AZL_017890
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.60E-153, Aligned region: 74..511
Protein Sequence: 518 a.a.     [Download]
>gi|288958630|ref|YP_003448971.1| hypothetical protein AZL_017890 [Azospirillum sp. B510]
MTGAAADPPDDDAEATVLERPLRLRAVDMALGRDRPGPLDAFLAATGPGEALRLWFGVTLPVHDSLDKLR
AALDRDIAAIDALLSEQVNAILHHRRFQALEASWRGVRTLVTQAQSSESVVLRLLTLTWAELCRDQERAI
EFDQSQLFNKIYSDEFGMPGGRPFGVLLCDYAVQHRPTRERPTDDVSGLKGLAQVAAAAFAPAIVGAAPE
LFGLETFHELGLPLDLKSVLRQAEYQRWQRFQETEDARFLGVALPRVLMRAPHGDDPQARHGFRFREESV
GGDEGGGLRLEDHCWGNAVYGFGTVLIRSFLAHGWFADIRGAQRDVIGGGLVTELVVPDFATDAARVARK
FAVEVSISDHLERDLDDLGFIPVSRCKDTPYLVFSGNQSVQRVGQYGNATAIANARLSAMLRYMFCVARF
AHFLKVMVRDRVGSFITPEDCERDLQSWLHGYCLGNDDASLDQKARYPLREGSIQVRAIPGKPGSYQCVI
HLRPHFQLDQVFSTFKLVTELAHTGGAA
 
Nucleotide Sequence: 1557 bp     [Download]
>gi|288956841|ref|NC_013854.1|:2042521-2044077 Azospirillum sp. B510 chromosome, complete genome
ATGACCGGAGCCGCGGCCGATCCGCCTGACGACGATGCCGAGGCGACGGTCCTTGAACGGCCGTTGCGTC
TGCGGGCGGTCGACATGGCGCTCGGCCGCGACCGCCCCGGACCGCTCGACGCCTTTCTGGCGGCGACAGG
ACCGGGCGAGGCGTTGCGCCTGTGGTTCGGCGTCACCCTGCCCGTCCATGACAGCCTGGACAAGCTGCGC
GCCGCCCTCGACCGCGACATCGCGGCGATCGACGCGCTGCTGTCCGAGCAGGTCAACGCCATCCTGCATC
ACCGACGCTTCCAGGCGCTGGAGGCGTCGTGGCGCGGGGTGCGCACGCTGGTGACGCAGGCGCAGTCCAG
CGAGAGCGTGGTGCTGCGCTTGTTGACCCTGACCTGGGCCGAGCTTTGCCGCGACCAGGAACGGGCGATC
GAGTTCGACCAGAGCCAGCTGTTCAACAAGATCTACAGCGACGAGTTCGGCATGCCGGGCGGGCGCCCGT
TCGGCGTGCTGCTGTGCGATTACGCGGTGCAGCACCGTCCGACGAGGGAACGGCCGACCGACGATGTGTC
CGGCCTGAAGGGGCTGGCCCAGGTCGCCGCCGCCGCCTTCGCCCCGGCCATCGTCGGGGCGGCGCCCGAG
CTGTTCGGGCTGGAGACCTTCCACGAGCTTGGCTTGCCGCTGGACTTGAAATCGGTGCTGCGACAGGCGG
AATACCAACGCTGGCAACGCTTCCAGGAGACCGAGGATGCGCGCTTCCTCGGCGTGGCGCTGCCGCGCGT
GCTGATGCGCGCGCCCCATGGCGACGACCCGCAGGCCCGCCACGGCTTCCGCTTCCGCGAGGAGTCGGTG
GGCGGGGATGAGGGCGGCGGCCTCCGGCTGGAGGATCATTGCTGGGGCAACGCGGTCTATGGCTTCGGCA
CCGTTCTGATCCGCTCCTTCCTCGCCCATGGCTGGTTCGCCGACATCCGCGGCGCCCAGCGCGATGTGAT
CGGCGGCGGTTTGGTGACGGAGCTGGTGGTGCCGGACTTCGCCACCGACGCCGCGAGGGTGGCGCGGAAA
TTCGCGGTCGAGGTCTCGATCTCCGACCATCTGGAGCGGGATCTCGACGATCTCGGCTTCATTCCGGTCA
GCCGCTGCAAGGACACGCCCTATCTGGTCTTTTCCGGCAACCAGTCGGTGCAGCGGGTCGGTCAATACGG
CAACGCCACGGCGATCGCCAACGCCCGGCTGTCGGCCATGCTGCGCTACATGTTCTGCGTGGCGCGCTTC
GCCCATTTCCTGAAGGTGATGGTGCGCGACCGCGTCGGCAGCTTCATCACGCCGGAGGATTGCGAGCGCG
ACCTGCAAAGCTGGCTGCACGGCTATTGCCTGGGCAACGACGACGCCAGCCTGGACCAGAAGGCGCGCTA
TCCCTTGCGCGAGGGCAGCATCCAGGTCCGCGCCATTCCGGGCAAGCCCGGCAGCTATCAATGCGTCATC
CATCTGCGGCCACACTTCCAGCTCGACCAGGTCTTCTCGACCTTCAAGCTGGTGACCGAACTGGCCCACA
CCGGCGGGGCGGCGTGA
 Primer design