SecReT6
Protein ID: 288958631
SecReT6 ID378
T6SS typei5
Gene symbol-
Locus tagAZL_017900
StrainAzospirillum sp. B510
Repliconchromosome [GenBank: NC_013854] [Browse all T6SS(s) in this replicon]
Location [Strand]2044115..2044912 [+]
ProductSciE type virulence protein
NoteTagJ
UniProt IDD3NVJ9
KEGG IDazl:AZL_017900
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 1.20E-32, Aligned region: 139..261
TPR_19 [PF14559], Evalue: 0.00047, Aligned region: 9..64
TPR_19 [PF14559], Evalue: 0.00047, Aligned region: 108..129
TPR_19 [PF14559], Evalue: 0.00047, Aligned region: 211..227
TPR_14 [PF13428], Evalue: 0.0049, Aligned region: 5..41
TPR_14 [PF13428], Evalue: 0.0049, Aligned region: 37..64
TPR_14 [PF13428], Evalue: 0.0049, Aligned region: 108..132
TPR_14 [PF13428], Evalue: 0.0049, Aligned region: 214..226
Protein Sequence: 265 a.a.     [Download]
>gi|288958631|ref|YP_003448972.1| SciE type virulence protein [Azospirillum sp. B510]
MSETAAQLFQGGRLDEAIAALNAEIRKKPTDLDRRVFLAELLSFAGNLERADLQLDTIGTQEPQVAVTMA
LFRQLVRAEQARVQLFADGRLPEFINQPAEHLRLHLEALVALRAGDAAAAVATLARAEELRPPVSGSHDG
AAFDDFRDLDDLTGGFFEVYTSTGKYFWIATETVELVEFRAPQRPRDLLWRPAHMVVRGGPDGEVYLPAI
YGGAPADAEAGLKLGRVTDWSEDEPVRGTGQRCFLVGEESVPMMQLGTLEFSGAV
 
Nucleotide Sequence: 798 bp     [Download]
>gi|288956841|ref|NC_013854.1|:2044115-2044912 Azospirillum sp. B510 chromosome, complete genome
ATGAGCGAAACCGCAGCCCAGCTTTTCCAGGGCGGCCGCCTCGACGAGGCGATCGCCGCGCTGAACGCCG
AAATCCGCAAGAAGCCGACCGACCTCGACCGCCGGGTCTTCCTGGCCGAGCTGCTGAGCTTCGCCGGCAA
TCTGGAGCGCGCCGACCTGCAACTGGACACCATCGGCACGCAGGAGCCGCAGGTCGCCGTCACCATGGCG
CTGTTCCGCCAGCTGGTGCGGGCCGAACAGGCGCGGGTCCAGCTTTTCGCCGACGGCCGCCTGCCGGAAT
TCATCAACCAGCCGGCCGAGCATCTGCGCCTGCATCTGGAGGCGCTGGTGGCTCTACGCGCCGGCGACGC
CGCCGCCGCGGTGGCGACGCTGGCCCGGGCGGAGGAGCTGCGTCCGCCGGTGTCGGGCAGCCATGACGGC
GCCGCGTTCGACGATTTCCGCGACCTGGACGATCTGACCGGCGGCTTCTTCGAGGTCTACACCAGCACCG
GCAAATATTTCTGGATCGCCACCGAGACGGTGGAGCTGGTGGAGTTCCGCGCGCCGCAGCGCCCGCGCGA
CCTGCTGTGGCGCCCGGCCCACATGGTGGTGCGCGGCGGCCCCGACGGCGAGGTTTATCTGCCGGCGATC
TATGGCGGCGCCCCGGCCGATGCCGAAGCCGGGCTGAAGCTGGGCCGGGTGACGGACTGGTCGGAGGATG
AGCCGGTGCGCGGGACCGGCCAGCGCTGCTTCCTCGTCGGCGAGGAGAGCGTCCCGATGATGCAGCTCGG
CACGCTGGAGTTCTCCGGCGCGGTATGA
 Primer design