SecReT6
Protein ID: 288958632
SecReT6 ID378
T6SS typei5
Gene symbol-
Locus tagAZL_017910
StrainAzospirillum sp. B510
Repliconchromosome [GenBank: NC_013854] [Browse all T6SS(s) in this replicon]
Location [Strand]2045000..2045476 [+]
Producthypothetical protein
NoteTssE
UniProt IDD3NVK0
KEGG IDazl:AZL_017910
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 4.60E-20, Aligned region: 30..137
Protein Sequence: 158 a.a.     [Download]
>gi|288958632|ref|YP_003448973.1| hypothetical protein AZL_017910 [Azospirillum sp. B510]
MDRDQPITLSVLDRLLDDTPEHAAPRPHTVADLRAAIRRDLENLLNTRRRVIGWPDDLTELADSILGYGC
HDLLVENIATEARRREVVTRIEAAIRLWEPRFAQLAVTMIDNGDPADRSLRFRIEALIHADPAPEPMIFD
SVVDPTSNMVSVTSKARG
 
Nucleotide Sequence: 477 bp     [Download]
>gi|288956841|ref|NC_013854.1|:2045000-2045476 Azospirillum sp. B510 chromosome, complete genome
ATGGATCGCGACCAGCCCATCACCCTGTCCGTCCTCGACCGTCTGCTCGACGACACGCCGGAGCATGCGG
CGCCACGCCCGCACACCGTGGCGGATCTGCGGGCGGCGATCCGGCGCGACCTGGAGAACCTGCTGAACAC
CCGGCGGCGGGTGATCGGCTGGCCGGACGACCTGACCGAGCTGGCGGATTCGATCCTCGGCTATGGCTGC
CATGATCTGCTGGTGGAGAATATCGCCACCGAAGCGCGCCGGCGCGAGGTGGTGACACGGATCGAGGCGG
CGATCCGGCTCTGGGAGCCGCGCTTCGCCCAGCTGGCGGTCACCATGATCGACAACGGCGACCCGGCCGA
CCGCAGCCTGCGCTTCCGGATCGAGGCGCTGATCCACGCCGACCCGGCGCCGGAGCCGATGATCTTCGAT
TCGGTCGTCGATCCCACCTCCAACATGGTCTCCGTGACGAGCAAGGCCCGTGGCTGA
 Primer design