SecReT6
Protein ID: 288958633
SecReT6 ID378
T6SS typei5
Gene symbol-
Locus tagAZL_017920
StrainAzospirillum sp. B510
Repliconchromosome [GenBank: NC_013854] [Browse all T6SS(s) in this replicon]
Location [Strand]2045469..2047301 [+]
Producthypothetical protein
NoteTssF
UniProt IDD3NVK1
KEGG IDazl:AZL_017920
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 5.10E-209, Aligned region: 5..610
Protein Sequence: 610 a.a.     [Download]
>gi|288958633|ref|YP_003448974.1| hypothetical protein AZL_017920 [Azospirillum sp. B510]
MADELLPYYNRELTYLRRMAAEFSEAHPKIAGRLRLSADAVEDPHVARLLEGVAFLNARISRKLDDEYPE
LVDTLLDVLYPHYLAPIPSMAVVQMKSSPDLTGAHTVPKGTELETEALRGESCRFRTVYPTTLWPVELDQ
AVLAGRPLMAPANPRAGDAVAALRLGLRCRVAEMSFTELGPDSLRVFLRGQPQQVYALHELIFNNTVSVA
LADDANDPDPVILGPDAIRPVGFGEEEGMLPYPARSQGGYRLLTEYFAFPEKFLFFDLTLSPKVLRRAGN
RMEVFLYLNSTDGDLERAVSRENFALGCTPVVNLFRQRAEPVALTQTQHEHRVVPDARRPGALEVYSVDG
VLATDPSGGQRRFLPFYGLRHGGVEAASRTYYTASRRPAGGRDPGTEVHLALVDLDFDPSSPADSVLSVE
TTCLNRDLPSQLPYGGGHPHLKLTEGMAAVAGVACLTPPTPTLRIAERKGHRWRLVSHLLLNHLSISGGA
EGTEALREILRLYDFRDSAETRGIADGIVTVTTRRGTARAPSRPGDVAWGDAMCRGIDVGIEFDPQRFSG
NGLFLLAMILDHFLGLYCSINSFTRLTATVKGRTGVLRTWPARAGNRPLL
 
Nucleotide Sequence: 1833 bp     [Download]
>gi|288956841|ref|NC_013854.1|:2045469-2047301 Azospirillum sp. B510 chromosome, complete genome
GTGGCTGACGAACTCCTTCCCTACTACAACCGCGAGCTGACCTATCTGCGCCGGATGGCGGCGGAATTCT
CGGAGGCGCACCCGAAGATCGCCGGCCGGCTGCGGCTGAGCGCCGACGCGGTGGAGGATCCCCATGTCGC
CCGGCTGCTGGAAGGCGTCGCCTTTCTCAACGCCCGCATCAGCCGCAAGCTGGACGACGAGTATCCGGAG
CTGGTGGACACGCTGCTCGACGTGCTCTACCCGCATTATCTGGCGCCCATCCCGTCGATGGCGGTGGTGC
AGATGAAGAGCAGCCCGGACCTGACCGGCGCCCACACCGTGCCCAAGGGAACCGAGCTGGAGACCGAGGC
GCTGCGCGGGGAAAGCTGCCGCTTCCGCACGGTCTACCCCACCACCCTGTGGCCGGTGGAGCTGGACCAG
GCGGTGTTGGCCGGACGGCCGCTGATGGCCCCGGCCAACCCACGGGCCGGCGACGCGGTGGCGGCGCTGC
GGCTCGGCCTGCGCTGCCGCGTCGCCGAGATGAGCTTCACCGAGTTGGGACCGGACAGCCTGCGCGTCTT
CCTGCGCGGCCAGCCGCAGCAGGTCTATGCTCTGCACGAGCTGATCTTCAACAACACGGTCTCGGTGGCG
CTTGCCGACGACGCGAACGACCCGGATCCGGTGATCCTCGGCCCCGACGCCATCCGCCCGGTGGGATTCG
GCGAGGAGGAGGGCATGCTGCCCTACCCCGCCCGCTCCCAGGGCGGCTACCGGCTGCTGACCGAATATTT
CGCCTTTCCCGAGAAATTCCTGTTCTTCGACCTGACCCTGTCGCCGAAGGTGCTGCGCCGGGCCGGCAAC
CGGATGGAGGTCTTCCTTTATCTGAACAGCACCGACGGCGACCTGGAGCGCGCGGTGTCCAGGGAGAATT
TCGCGCTGGGCTGCACCCCGGTGGTCAATCTGTTCCGCCAGCGGGCGGAGCCGGTGGCGCTGACCCAGAC
CCAGCACGAGCACCGCGTGGTTCCCGACGCCCGCCGCCCCGGCGCGCTGGAGGTCTATTCGGTCGACGGC
GTGCTCGCCACCGATCCCAGCGGCGGCCAGCGGCGCTTCCTGCCCTTCTACGGCCTGCGCCATGGCGGGG
TAGAGGCGGCCAGCCGCACCTATTACACCGCCAGCCGCCGCCCGGCCGGCGGGCGCGATCCGGGGACGGA
GGTGCATCTGGCGCTGGTCGATCTCGATTTCGACCCGTCGAGCCCGGCGGATTCGGTGCTGTCGGTGGAG
ACCACTTGCCTGAACCGCGACCTGCCGTCGCAGTTGCCCTATGGCGGCGGCCATCCGCATCTGAAGCTGA
CGGAAGGGATGGCGGCGGTGGCCGGTGTGGCCTGCCTGACGCCGCCGACCCCGACCCTGCGCATCGCCGA
GCGCAAGGGCCACCGCTGGCGCCTCGTCTCCCATCTGCTGCTGAACCATCTGTCGATCTCCGGCGGAGCG
GAGGGAACCGAAGCGTTGCGCGAGATCCTGCGGCTCTATGATTTCCGCGATTCCGCCGAGACGCGCGGCA
TCGCCGACGGCATCGTCACGGTGACGACCAGGCGCGGCACCGCGCGGGCGCCGTCGCGGCCGGGCGATGT
CGCCTGGGGCGACGCCATGTGCCGGGGCATCGATGTCGGCATCGAATTCGACCCGCAGCGCTTCAGCGGC
AACGGCCTGTTCCTGCTGGCGATGATTCTCGACCATTTCCTGGGGCTGTACTGCTCGATCAATTCCTTCA
CGCGGCTGACCGCCACGGTCAAGGGCCGCACCGGAGTGCTCCGCACATGGCCCGCCCGCGCCGGCAACCG
CCCGCTTCTGTGA
 Primer design