SecReT6
Protein ID: 288958634
SecReT6 ID378
T6SS typei5
Gene symbol-
Locus tagAZL_017930
StrainAzospirillum sp. B510
Repliconchromosome [GenBank: NC_013854] [Browse all T6SS(s) in this replicon]
Location [Strand]2047265..2048350 [+]
Producthypothetical protein
NoteTssG
UniProt IDD3NVK2
KEGG IDazl:AZL_017930
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 7.30E-101, Aligned region: 18..342
Protein Sequence: 361 a.a.     [Download]
>gi|288958634|ref|YP_003448975.1| hypothetical protein AZL_017930 [Azospirillum sp. B510]
MARPRRQPPASVIDRLFRAPHRFDFFQAVRVLEWQARRDARDPRNARRHAVGHDHDPREEVVRLRAETSL
TFPGNQVAGAEPGQDGRPPTLVGAFLGLVGPLGVLPQHYTEMMIRSLRERNRALRDFLDVFHHRSFSLFY
RAWAKYRLPVSYERGQGAREPDPVTATLSSVVGIAQPALAKRLTVEDETLLHYSGLLSRGPRSATDLQEM
LSEFLGRPVTVESFVGGWLPIAADGQTRLPGPPAPDGQHCRLGIDALAGERAWDVQGKFRLRIGPLTHDQ
FRDFMPEGREFGKLRDLVRMYVGPELDFELQVSLGAPEVPAARLAAGEDDRDATRLGWNGWVLHAPSPVE
RKDAVFPMQDL
 
Nucleotide Sequence: 1086 bp     [Download]
>gi|288956841|ref|NC_013854.1|:2047265-2048350 Azospirillum sp. B510 chromosome, complete genome
ATGGCCCGCCCGCGCCGGCAACCGCCCGCTTCTGTGATCGACCGGCTGTTCCGCGCCCCGCACCGCTTCG
ATTTCTTCCAGGCGGTGCGGGTGCTGGAATGGCAGGCCCGGCGTGATGCGCGCGACCCGCGCAACGCCCG
CCGCCACGCCGTCGGCCATGACCATGACCCGCGCGAGGAGGTGGTGCGGCTGCGCGCCGAGACCTCGCTG
ACCTTCCCCGGCAATCAGGTGGCGGGGGCGGAGCCGGGGCAGGACGGACGGCCACCCACGCTGGTCGGCG
CCTTCCTGGGGCTGGTCGGGCCGCTGGGCGTCCTGCCGCAGCATTACACCGAGATGATGATCCGCAGCTT
GCGCGAGCGGAACCGGGCGCTGCGCGATTTCCTCGATGTCTTCCACCACCGCAGCTTCTCGCTGTTCTAC
CGCGCCTGGGCCAAATACCGGCTGCCGGTGTCCTACGAGCGCGGCCAGGGCGCGCGGGAGCCGGATCCGG
TCACCGCCACCCTGTCCAGCGTCGTCGGCATCGCCCAGCCCGCGCTCGCCAAGCGGCTGACGGTGGAGGA
CGAGACCCTTCTGCATTATTCCGGCCTGCTGTCGCGCGGCCCGCGCTCCGCCACCGACCTGCAGGAGATG
CTGTCGGAGTTTCTCGGCCGGCCGGTGACGGTGGAGAGCTTCGTCGGCGGCTGGCTGCCGATCGCGGCGG
ACGGACAGACCCGGCTTCCCGGCCCGCCGGCCCCCGACGGCCAGCATTGCCGGCTGGGCATCGACGCGCT
GGCCGGCGAACGCGCCTGGGATGTCCAGGGCAAGTTCCGCCTGCGCATCGGCCCGCTGACGCATGACCAG
TTCCGCGACTTCATGCCGGAGGGCCGCGAGTTCGGGAAGCTGCGGGATCTGGTCCGCATGTATGTCGGAC
CGGAGCTGGATTTCGAGCTTCAGGTGAGCCTGGGGGCGCCGGAGGTGCCGGCCGCCCGGCTGGCCGCCGG
GGAGGATGACCGCGACGCCACGCGGCTGGGCTGGAACGGCTGGGTGCTGCACGCGCCGAGCCCGGTCGAG
CGCAAGGACGCGGTGTTTCCGATGCAGGATTTGTGA
 Primer design