SecReT6
Protein ID: 288958637
SecReT6 ID378
T6SS typei5
Gene symbol-
Locus tagAZL_017960
StrainAzospirillum sp. B510
Repliconchromosome [GenBank: NC_013854] [Browse all T6SS(s) in this replicon]
Location [Strand]2050988..2051614 [+]
Producthypothetical protein
NoteTssJ
UniProt IDD3NVK5
KEGG IDazl:AZL_017960
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.30E-34, Aligned region: 17..149
Protein Sequence: 208 a.a.     [Download]
>gi|288958637|ref|YP_003448978.1| hypothetical protein AZL_017960 [Azospirillum sp. B510]
MRIRKTIWSAATLAAALALPACSSAPPAPTTISLTVAGATALNPDPSGRASPVMLRLYQLGPSDAFANAD
FFQVIDQDKATLGPTLLDRQEMAVQPGSRQTVTIQPKPDVRILAVAAAFRAYEEAGWRAMLAVEPNKANR
FVLTAKASAITLTRRGEDDDESGDTAAETPDGNKPEGDKPEGGKPKTEGAKPDQQPAAKHNLIVKGPS
 
Nucleotide Sequence: 627 bp     [Download]
>gi|288956841|ref|NC_013854.1|:2050988-2051614 Azospirillum sp. B510 chromosome, complete genome
ATGCGGATCCGGAAGACGATTTGGTCCGCCGCCACCCTGGCCGCGGCGCTGGCGCTGCCCGCCTGTTCCT
CAGCGCCGCCGGCGCCGACCACGATCAGCCTGACGGTGGCGGGGGCGACGGCGCTGAACCCCGACCCCAG
CGGCCGTGCCTCGCCGGTGATGCTGCGCCTCTATCAGCTCGGCCCCAGCGACGCCTTCGCCAACGCCGAC
TTCTTCCAGGTCATCGACCAGGACAAGGCGACGCTCGGCCCGACCCTGCTCGACCGGCAGGAGATGGCGG
TGCAACCCGGCAGCCGCCAGACCGTCACCATCCAGCCCAAGCCGGACGTCAGGATCCTGGCCGTCGCCGC
CGCCTTCCGCGCCTATGAGGAGGCGGGCTGGCGCGCCATGCTGGCGGTCGAGCCGAACAAGGCCAACCGC
TTCGTCCTGACCGCCAAGGCCAGCGCCATCACGCTGACCCGCCGGGGCGAGGACGACGACGAGAGCGGCG
ACACGGCGGCGGAAACGCCCGACGGTAACAAGCCTGAAGGCGACAAGCCCGAAGGCGGCAAGCCGAAGAC
GGAAGGCGCCAAACCGGACCAACAGCCTGCCGCCAAACACAATCTGATCGTGAAGGGGCCGTCATGA
 Primer design