SecReT6
Protein ID: 288958638
SecReT6 ID378
T6SS typei5
Gene symbol-
Locus tagAZL_017970
StrainAzospirillum sp. B510
Repliconchromosome [GenBank: NC_013854] [Browse all T6SS(s) in this replicon]
Location [Strand]2051611..2053119 [+]
ProductompA-family protein
NoteTssL
UniProt IDD3NVK6
KEGG IDazl:AZL_017970
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 6.30E-68, Aligned region: 105..310
DUF2077 [PF09850], Evalue: 6.30E-68, Aligned region: 315..346
OmpA [PF00691], Evalue: 1.30E-12, Aligned region: 391..494
Protein Sequence: 502 a.a.     [Download]
>gi|288958638|ref|YP_003448979.1| ompA-family protein [Azospirillum sp. B510]
MSVRPPSDKNPFEEMDDIDATVMQPMAFQRPAAPSATPAGVVPPAFGQGAPPSATVPPAFAPPAFASALR
PAAAPVGAAAPAPLSPGFRPLDDAALTALAAVSDNPLVIAAAPILAMVVRVRDLPQHRDVESLRERVIAE
MQRFETATLRAGLSNTQIRNAGYALCATVDDVVLATPWGGQSLWAHKSMVSTIQTETWGGERFFDLLDQM
ADTPDRHLMELELFYLCLSLGFEGKYRVMPRGHSELAKLRDRLYRVIRKQRGEAERDLSPRWRGQADGFR
PLAASVPLWLPAALVVVLLAALYAWFVYALADQSDAARRRLAALIPDKPVQIARIEPPATLPTPPPGSVV
AGRTVVERVTLALAADIRAGLVEVSGGTDGRVLVRTRLNVFASGSDRIEPRYVELFRHVAEALRPEQGRI
SVIGNTDSVAIRSTRYRSNQELSEARAFRVQRLMTDILGKDAGRDGGSRLSAEGRGDGDPIAPNTTAEGR
QANRRVDIVLVP
 
Nucleotide Sequence: 1509 bp     [Download]
>gi|288956841|ref|NC_013854.1|:2051611-2053119 Azospirillum sp. B510 chromosome, complete genome
ATGAGCGTCCGGCCGCCGTCCGACAAGAATCCGTTCGAGGAGATGGACGACATCGACGCCACGGTGATGC
AGCCGATGGCGTTCCAGCGTCCCGCGGCGCCGAGCGCGACCCCCGCCGGGGTCGTGCCGCCCGCCTTCGG
GCAGGGCGCCCCCCCGTCCGCGACCGTGCCGCCCGCCTTCGCTCCGCCGGCCTTCGCATCCGCCCTCCGG
CCCGCCGCCGCCCCGGTCGGCGCGGCCGCCCCCGCCCCGCTCTCCCCCGGCTTCCGGCCGCTGGACGACG
CGGCGCTGACGGCGCTGGCCGCGGTCAGCGACAACCCGCTGGTCATCGCCGCCGCCCCCATCCTGGCGAT
GGTGGTGCGGGTGCGCGACCTGCCCCAGCACCGCGATGTCGAATCGCTGCGCGAACGGGTGATCGCCGAG
ATGCAGCGGTTCGAGACGGCGACGCTGCGCGCCGGCCTGTCCAACACCCAGATCCGCAACGCCGGCTATG
CGCTCTGCGCCACGGTGGACGATGTGGTGCTGGCGACCCCCTGGGGCGGCCAGAGCCTGTGGGCGCACAA
GAGCATGGTCTCCACCATCCAGACGGAGACCTGGGGCGGTGAGCGCTTCTTCGACCTGCTGGACCAGATG
GCCGACACGCCCGACCGCCACCTGATGGAGCTGGAGCTGTTCTACCTCTGCCTCTCGCTGGGGTTCGAGG
GCAAATACCGGGTCATGCCGCGCGGCCACAGCGAACTGGCCAAGCTGCGCGATCGTCTGTACCGCGTCAT
CCGCAAGCAGCGCGGCGAGGCGGAGCGCGACCTGTCACCCCGTTGGCGCGGCCAGGCCGACGGCTTTCGC
CCGCTGGCCGCCTCGGTGCCGCTGTGGCTGCCGGCTGCCCTCGTCGTCGTCCTGCTGGCGGCGCTCTATG
CCTGGTTCGTCTATGCCCTGGCCGACCAGTCCGACGCCGCCCGGCGGCGGCTTGCCGCGCTGATCCCGGA
CAAGCCGGTGCAGATCGCCCGGATAGAACCGCCGGCGACCCTGCCCACCCCGCCGCCGGGCAGCGTTGTG
GCGGGCAGGACGGTGGTGGAGCGCGTCACCCTCGCGCTCGCCGCCGACATCCGGGCGGGGCTGGTGGAGG
TGAGCGGCGGCACCGACGGACGCGTGCTGGTCCGCACCCGGCTGAACGTCTTCGCGTCGGGCAGCGACCG
CATCGAGCCGCGCTATGTCGAGCTGTTCCGCCATGTCGCCGAGGCGCTGCGCCCGGAACAGGGCCGGATT
TCGGTGATCGGCAACACCGACTCCGTCGCCATCCGCTCGACGCGCTACCGCTCCAACCAGGAGTTGTCGG
AGGCGCGGGCGTTCCGGGTGCAGAGGCTGATGACCGACATCCTCGGCAAGGATGCGGGGAGGGATGGCGG
AAGCCGGCTCAGCGCCGAAGGGCGCGGCGACGGCGACCCCATCGCCCCCAACACGACGGCGGAGGGCCGG
CAGGCCAACCGGCGCGTCGACATCGTGCTGGTGCCCTGA
 Primer design