SecReT6
Protein ID: 288958639
SecReT6 ID378
T6SS typei5
Gene symbol-
Locus tagAZL_017980
StrainAzospirillum sp. B510
Repliconchromosome [GenBank: NC_013854] [Browse all T6SS(s) in this replicon]
Location [Strand]2053123..2056809 [+]
Producthypothetical protein
NoteTssM
UniProt IDD3NVK7
KEGG IDazl:AZL_017980
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 4.80E-91, Aligned region: 98..121
ImcF-related_N [PF14331], Evalue: 4.80E-91, Aligned region: 205..467
IcmF-related [PF06761], Evalue: 1.50E-84, Aligned region: 524..826
DUF1215 [PF06744], Evalue: 6.50E-38, Aligned region: 963..1087
Protein Sequence: 1228 a.a.     [Download]
>gi|288958639|ref|YP_003448980.1| hypothetical protein AZL_017980 [Azospirillum sp. B510]
MLKPILSALTSLWFLTLAAALSLGALVWFVGPLIAVAGAFPLADATVRLGVAAGILLVWALAMQWSLYRH
RSANDRMVQALSKATPATAAGAANGADPQAEAVGQETALLRTRLRDALDQLRKARFGGKWGQRYLYQLPW
YLLIGAPGAGKTTALANSGLRFPLAAEMGHAALRDVGGTRNCDWWFTDEAVLIDTAGRYVTQDSQPAVDG
RVWKNFIALLKRHRPRQPVNGILLAVSLADLTVWSEAERRSHAEQLKLRLKELRGQVGSRVPVYVLLTKA
DLIAGFAEFFDDLSREEREQVWGVTFPLDDGKSGDDAPVHRFGAEFDALTGRIARRVLDRVHGESDIQRR
SLDTLFPAQMAALKPAIADLLAVIFEPNRYEERPLLRGVYLTSGTQTGAPVDRLAEMVAGSFGLERPVLP
AASGGRSYFLTRTLREVVFAEAGLVGTDGGMERRRRLLRGGAMAAMLLAGLAVAAFWANSFTGNAALVAG
VDAAAAKAQAELAPLATAPRSLTRVDDTDFAAIVPPLNTLRAIPAGWTEPPPPEMTGGLYQGGRLGRQGA
DIYARALDTVLLPRVFLRMEEQLRRERARPDYLFQALKVYLMLAGKGPLDKALVSEWMALEWMASLPGPA
YDGVRRDLRGHLDTLLANPLPGLPLDEALVEEARQSLTRYPLAERGFTILRDRPEIQDLDDWRLVDNAGP
LAGRVLVRPSGKPLSEGVPGLYSYDGFHKAVLPALPKVAKALVDENWVLGQPSSGPQALASARQLERGIL
AVYLDRYARQWDEMLGDVVIVPLRSLSQAADVLNTLSGPQSPLKLWLTAMVRQTTLVPGPTDKPADGKGP
AAGGPVAGGPLAGAAQQAQAAGKAVESTGANAAYLARLAGVSLQPEGPPPGQPINDHFKALRALVQGEGG
APPKLDESLKLLGDLYQQIARAANAPDQNGALLAGLAGTAGAGDGKGAVAAQLRTLARDLPDPVGGMVAG
VAQNAATVSAGGARAQINKAWQSTVLPFCRAALDNRFPMVAGSPVDVTAADFAKLFAPGGMIDQFFNTNL
RPFVDMTVSPWAWQKVDQVDLGIPPAVLDQFERAARIRDSLFPAGAAAAKVVFEITPVELDAKATQVAMD
IDGQTLIYQHGPPRPQVMKWPGAEGTSSVRLGFGPPLPGEPAGLSRQGPWALFHFLADGKLEPTPQPDRF
TFAVTVGTRKAVFALRADSVNNPFGKNLLESFRCPTAL
 
Nucleotide Sequence: 3687 bp     [Download]
>gi|288956841|ref|NC_013854.1|:2053123-2056809 Azospirillum sp. B510 chromosome, complete genome
ATGCTGAAACCGATCCTGTCCGCCCTGACCTCCCTATGGTTCCTGACGCTGGCGGCGGCGCTGTCGCTGG
GCGCGCTGGTCTGGTTCGTCGGGCCGCTGATCGCGGTGGCCGGCGCCTTCCCGCTGGCCGACGCGACCGT
CCGGCTCGGGGTTGCGGCCGGCATCCTGCTGGTCTGGGCACTGGCGATGCAATGGTCGCTCTACCGCCAC
CGCAGCGCCAACGACCGCATGGTGCAGGCGTTGAGCAAGGCGACGCCGGCCACCGCCGCCGGTGCCGCCA
ACGGGGCCGATCCGCAGGCCGAGGCCGTCGGCCAGGAGACCGCCCTGCTGCGCACCCGGCTGCGCGACGC
GCTCGACCAGCTGCGCAAGGCGCGGTTCGGCGGCAAATGGGGGCAGCGCTACCTCTACCAACTGCCCTGG
TATCTGCTGATCGGCGCGCCGGGGGCCGGCAAGACGACGGCGCTGGCCAATTCCGGCCTGCGCTTCCCGC
TCGCCGCCGAGATGGGGCATGCGGCGCTGCGCGATGTCGGTGGCACCCGCAATTGCGACTGGTGGTTCAC
CGACGAGGCGGTGCTGATCGACACCGCCGGGCGCTACGTCACCCAGGACAGCCAGCCGGCCGTCGACGGC
AGGGTTTGGAAGAATTTCATCGCCCTGCTGAAGCGCCACCGCCCGCGCCAGCCGGTGAACGGCATCCTGC
TGGCCGTCAGCCTCGCCGATCTCACGGTGTGGAGCGAGGCGGAGCGCCGGAGCCATGCCGAACAGCTGAA
GCTGCGGCTGAAGGAGCTGCGCGGGCAGGTCGGGTCGCGCGTGCCGGTCTATGTGCTGTTGACCAAGGCC
GACCTGATCGCCGGCTTCGCCGAATTCTTCGACGATCTCAGCCGCGAGGAACGCGAGCAGGTCTGGGGCG
TCACCTTCCCGCTCGATGACGGCAAATCGGGGGACGACGCCCCGGTCCACCGCTTCGGCGCCGAGTTCGA
CGCGCTGACCGGGCGCATCGCCCGCCGGGTGCTCGACCGCGTCCATGGCGAATCCGACATCCAGCGCCGG
TCGCTCGACACCCTGTTCCCGGCGCAGATGGCGGCGCTGAAGCCGGCCATCGCCGACCTGCTGGCGGTCA
TCTTCGAGCCCAACCGCTATGAGGAGCGCCCGCTGCTGCGCGGCGTCTACCTGACCAGCGGCACCCAGAC
CGGCGCGCCGGTGGACCGGCTGGCGGAGATGGTCGCCGGCTCCTTCGGGCTGGAGCGGCCGGTGCTGCCG
GCGGCCAGCGGCGGGCGCAGCTATTTCCTGACCCGAACCCTGCGCGAGGTGGTGTTCGCCGAGGCCGGGC
TGGTCGGCACCGACGGCGGGATGGAGCGCCGCCGTCGCCTGCTGCGCGGCGGGGCGATGGCGGCGATGCT
GCTGGCCGGGCTGGCGGTCGCCGCCTTCTGGGCCAACAGCTTCACCGGCAACGCCGCCCTGGTCGCCGGG
GTCGATGCCGCCGCCGCCAAGGCGCAGGCCGAGCTGGCGCCGCTCGCCACCGCGCCGCGCTCGCTGACCA
GGGTGGACGACACCGATTTCGCCGCCATCGTGCCGCCGCTGAACACGCTGCGCGCCATCCCCGCCGGATG
GACCGAGCCGCCACCGCCGGAGATGACCGGCGGCCTCTATCAGGGCGGCCGGCTGGGGCGGCAAGGGGCC
GATATCTATGCCCGCGCGCTCGACACCGTGCTGCTGCCCCGCGTCTTCCTGCGGATGGAGGAGCAGCTTC
GCCGCGAGCGCGCCCGGCCCGACTATCTGTTCCAGGCGCTGAAGGTCTATCTGATGCTGGCCGGCAAGGG
GCCGCTCGACAAGGCGCTGGTGTCGGAGTGGATGGCGCTGGAATGGATGGCCTCGCTGCCCGGCCCGGCC
TATGACGGGGTGCGGCGCGACCTGCGCGGCCATCTCGATACCCTGCTGGCCAATCCGCTGCCCGGCCTGC
CGCTGGACGAGGCGCTGGTGGAGGAGGCGCGGCAGAGCCTGACCCGCTATCCGCTGGCCGAGCGCGGCTT
CACCATCCTGCGCGACCGGCCGGAAATCCAGGATCTGGACGATTGGCGGCTGGTCGACAATGCCGGGCCG
CTGGCCGGGCGGGTGCTGGTCCGCCCGTCGGGCAAGCCGCTGTCGGAGGGGGTGCCCGGCCTCTACAGCT
ATGACGGCTTCCACAAGGCGGTGCTGCCGGCACTGCCCAAGGTGGCCAAGGCGCTGGTGGACGAGAATTG
GGTGCTGGGCCAGCCGAGCAGCGGCCCGCAGGCGCTCGCCAGCGCCCGGCAGCTCGAACGCGGCATCCTC
GCCGTCTATCTCGACCGCTATGCCCGCCAATGGGACGAAATGCTGGGCGACGTGGTGATCGTGCCGCTGC
GCAGCCTGTCCCAGGCCGCCGACGTGCTGAATACTTTGTCCGGCCCGCAATCGCCGCTGAAGCTGTGGCT
GACCGCCATGGTGCGCCAGACCACGCTCGTCCCCGGCCCGACCGACAAGCCGGCCGACGGCAAGGGACCG
GCTGCCGGGGGACCGGTTGCCGGAGGGCCGCTGGCCGGGGCGGCGCAGCAGGCGCAGGCGGCCGGGAAGG
CGGTGGAGTCGACCGGCGCCAACGCCGCCTATCTGGCGCGGCTGGCCGGCGTGTCGCTGCAACCGGAGGG
GCCGCCGCCGGGCCAGCCGATCAACGACCATTTCAAGGCGCTGCGCGCGCTGGTCCAGGGCGAGGGCGGC
GCGCCGCCCAAGCTGGACGAGTCGCTGAAGCTGCTGGGCGACCTTTATCAGCAGATCGCGCGGGCGGCCA
ACGCGCCCGACCAGAACGGCGCCCTTCTGGCCGGGCTGGCCGGCACCGCCGGGGCCGGTGACGGCAAGGG
GGCGGTGGCGGCGCAGCTGCGCACGCTCGCCCGCGACCTGCCCGATCCGGTCGGCGGCATGGTGGCCGGC
GTGGCGCAGAATGCGGCGACGGTCAGCGCCGGCGGGGCCAGGGCACAGATCAACAAGGCGTGGCAATCCA
CCGTCCTGCCCTTCTGCCGGGCGGCGCTCGACAACCGCTTCCCGATGGTGGCGGGCAGTCCGGTGGATGT
GACCGCGGCCGATTTCGCCAAGCTGTTCGCCCCGGGCGGCATGATCGACCAGTTCTTCAACACCAACCTG
CGCCCCTTCGTCGACATGACGGTCAGCCCCTGGGCCTGGCAGAAGGTCGATCAGGTCGATCTCGGCATCC
CGCCGGCGGTGCTCGACCAGTTCGAGCGGGCGGCCCGCATCCGCGACAGCCTGTTCCCGGCCGGGGCCGC
CGCCGCCAAGGTGGTGTTCGAGATCACGCCGGTGGAGCTGGACGCCAAGGCGACCCAGGTGGCGATGGAC
ATCGACGGCCAGACGCTGATCTACCAGCATGGGCCGCCCCGTCCGCAGGTGATGAAATGGCCGGGGGCGG
AAGGCACCAGCAGCGTGCGGCTCGGCTTCGGCCCGCCGCTGCCGGGCGAGCCCGCCGGCCTGTCGCGCCA
GGGACCATGGGCCTTGTTCCATTTCCTCGCCGACGGCAAGCTGGAGCCGACGCCGCAGCCCGACCGCTTC
ACCTTCGCGGTGACGGTCGGCACCCGCAAGGCGGTCTTCGCCCTGCGCGCCGACAGCGTGAACAACCCCT
TCGGCAAGAATCTGCTCGAGAGCTTCCGATGCCCGACGGCGCTGTAG
 Primer design