SecReT6
Protein ID: 288959894
SecReT6 ID379
T6SS typei4a
Gene symbol-
Locus tagAZL_a01590
StrainAzospirillum sp. B510
Repliconplasmid pAB510a [GenBank: NC_013855] [Browse all T6SS(s) in this replicon]
Location [Strand]180606..184820 [-]
Producthypothetical protein
NoteTssM
UniProt IDD3NZ61
KEGG IDazl:AZL_a01590
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.20E-33, Aligned region: 157..342
ImcF-related_N [PF14331], Evalue: 1.20E-33, Aligned region: 341..378
Protein Sequence: 1404 a.a.     [Download]
>gi|288959894|ref|YP_003450234.1| hypothetical protein AZL_a01590 [Azospirillum sp. B510]
MDILGTVLAGIAQNQLWFFAALLLVVLAIIAVMAVILLRAGRQPAEPPGEVKALPAPEGADPAAGPGASG
LPATLPIVGTRDLRRLFREGLAAYRETLSRNVYLVPWYLRTGVVPGDDGGLLTCAEEVRPPVESKDRPFG
FHWRFYDRAVVIDIDDARVAWKGVLDQLARYRVMMPVDGVILTVPLEELDDVRRATARGTELYARLWEIQ
RTLGLALPVYVVVTGCDAIPGFPLFVDALPEPMRDGMLGWSSSYALETVFRPDFVGEALQSMAAGMLALQ
LEVFGAASREDGAQLVALIDRLAGTEAALRAMLGIAFKRTAYQETLYVRGLYFVGRTAPETPAVFGRDLL
NRKIFPEAGLPKPTRALAATRALRHHAWPVGTAVASAAAILLLWIGVHRVNTLSDQLVPILSDIPANLQQ
LSDQRAAIQAGAPPPPIYADAAARFVQGMATLPQDPPFNPLPAAWISGVPDDVARALAVGYRRLTLATMR
DIAEDRLRRLTRDPLRVQIGAGGFDRLRAFTTEVGIAEGLARAYNTVDSRDPNMPLDEALEFSLGSTGAR
GFSARLHGWGVDVPPMGGAVPAPGPGAQRPIDLAAYRGEVTSRFRQFADAYLRELAMSGLAVARLSVAAS
ELELLAGGARTGADAATSYTEVLAGLDEAARGLNLEHGAWIGTDGPVLPPEFDTLLNRLEKSELFGPTLR
ADIKELAQRRYDEAGTGGKSLDSVIGRLLVQGPSGAPRLSPAAESLRQTLSVWTARRFMRSGETSGMTAT
PAAGASWDRAALETIPPLLEDYLLFDAKDLPQAPQILRPSMRAAAQHQLRRGVEQILARALAGTPAGGTI
DRAGGLTQLRESARSLRLAFPVLAETIQNFRQIGLATSADAIRDIVARQANAVLAQADRMLEEDQLYRPD
TRSLNAWIDGPLVPAQLFGQQSPTALALYLGNARQEVTALTRDVAAPVVEILEKPVMGGGEGSGLSAKWA
RIVAELDRYEGGRPNSTLAVLEKFVTTDVAAIDAASCRDTAQFDALASDFFASRLNELKQSIADRCRLMG
DQRVYMGYAEIAAAFNASLAGRFPFGPISDNQADVAMVRAFYDAFDARQGSVIEGLRRSTRLGTAGHDAL
RFMETMAMAKPALTAATVTDQTGGLLLDPTFRVNRGREAGGTNIIEWKLSTSAGSIANIGARAPLRWYPG
DRVAVSLRWAKDGKVVPVTGIGAPSAVDDATLTFAYEGPWALFALVRQHNAAQRDRSSGADTVLLFEALT
KAVPVVEDADGKEAEDKAKREGPLPLSAAPLPGKPGALSAPDARRADTRVFMALGAKRTIVTEGKPPRDE
KVALLELPSSAPLLLSAGAMPRPGFPGAPPAGLTGFPSATFGGQAVNPTDRAFFDLQAPPGVPPLLRPAN
QRVY
 
Nucleotide Sequence: 4215 bp     [Download]
>gi|288959735|ref|NC_013855.1|:c184820-180606 Azospirillum sp. B510 plasmid pAB510a, complete sequence
ATGGATATTCTCGGCACCGTCCTGGCGGGCATCGCGCAGAACCAGCTGTGGTTCTTCGCGGCGCTGCTGC
TGGTGGTCCTCGCCATCATCGCTGTCATGGCGGTGATCCTGCTGCGCGCCGGCCGCCAGCCGGCCGAGCC
GCCGGGCGAGGTCAAAGCGCTGCCGGCACCCGAGGGCGCCGATCCCGCCGCGGGGCCGGGAGCGTCCGGG
CTGCCCGCGACGCTGCCCATCGTCGGCACGCGCGACCTCCGCCGCCTGTTCCGCGAGGGACTGGCGGCCT
ATCGCGAAACGCTGTCGCGCAACGTCTATCTGGTCCCCTGGTATCTGCGTACCGGCGTCGTCCCCGGGGA
CGACGGCGGCCTGCTGACCTGCGCCGAGGAGGTGCGGCCGCCGGTGGAGTCCAAGGACCGGCCCTTCGGC
TTCCACTGGCGCTTTTACGACCGCGCGGTGGTAATCGACATCGACGACGCCCGTGTGGCATGGAAGGGCG
TGCTCGACCAGCTTGCCCGCTATCGCGTCATGATGCCGGTCGACGGCGTGATCCTGACCGTACCGCTGGA
GGAACTCGACGATGTCCGCCGCGCCACCGCGCGCGGCACCGAGCTTTACGCCCGCCTGTGGGAGATCCAG
CGCACTCTCGGGCTGGCGCTGCCGGTCTATGTGGTGGTCACCGGCTGCGATGCCATTCCCGGCTTCCCGT
TGTTCGTCGATGCGCTGCCCGAGCCCATGCGCGACGGCATGCTCGGCTGGTCGTCCTCCTACGCGCTGGA
GACGGTGTTCAGGCCTGACTTCGTCGGTGAGGCGCTTCAGTCCATGGCTGCCGGCATGCTGGCCCTCCAG
CTCGAAGTGTTCGGCGCGGCATCTCGGGAGGACGGGGCGCAGCTCGTGGCGCTGATCGACCGGCTGGCCG
GGACGGAGGCGGCGCTGCGCGCCATGCTCGGCATCGCCTTCAAGCGCACCGCCTACCAGGAAACGCTGTA
TGTCCGCGGCCTGTATTTCGTTGGCCGGACGGCGCCGGAAACGCCTGCCGTCTTCGGCCGCGACCTGCTC
AACCGCAAGATCTTCCCCGAGGCGGGGCTGCCCAAGCCGACCCGCGCGCTCGCCGCGACCCGTGCCCTGC
GCCACCATGCCTGGCCGGTCGGCACCGCCGTCGCCTCTGCCGCCGCGATCCTGCTCCTGTGGATCGGCGT
GCACCGGGTGAACACGCTGTCGGACCAGCTGGTGCCGATCCTTTCGGACATCCCGGCGAACCTCCAGCAG
CTCTCCGACCAGCGCGCTGCCATTCAGGCCGGCGCGCCGCCGCCGCCGATCTATGCCGATGCCGCCGCGC
GTTTCGTTCAGGGCATGGCGACCCTGCCGCAGGACCCGCCGTTCAATCCGCTGCCGGCCGCCTGGATCAG
CGGCGTGCCCGACGATGTGGCCCGTGCACTGGCCGTCGGTTATCGCCGGCTGACGCTGGCGACCATGCGC
GATATCGCCGAGGACCGGTTGCGCCGCCTGACCCGCGACCCGCTTCGCGTGCAGATCGGTGCGGGCGGAT
TCGACCGGCTGCGCGCCTTCACCACCGAGGTGGGCATCGCCGAAGGCTTGGCCAGGGCCTACAACACCGT
CGATTCCCGTGATCCCAATATGCCGCTCGACGAGGCGCTGGAGTTCTCGCTGGGCTCCACCGGGGCGCGC
GGCTTCTCCGCACGGCTGCATGGCTGGGGCGTCGACGTGCCGCCAATGGGCGGTGCCGTCCCGGCCCCCG
GTCCCGGCGCGCAGCGGCCGATCGACCTGGCCGCCTATCGCGGTGAAGTCACGAGCCGCTTCCGCCAGTT
CGCCGACGCCTATCTGCGTGAGCTTGCCATGAGCGGTCTCGCCGTGGCCCGTCTTTCGGTTGCCGCCAGC
GAGCTTGAGCTGCTGGCGGGAGGCGCGCGCACCGGCGCCGACGCCGCAACCTCCTACACCGAGGTGCTGG
CGGGCCTGGATGAGGCCGCGCGCGGCCTGAATTTGGAACACGGCGCTTGGATCGGCACCGATGGCCCGGT
GCTGCCGCCCGAGTTCGACACCCTTCTCAACCGCCTGGAGAAGTCCGAGCTGTTCGGCCCGACGCTGCGT
GCCGACATCAAGGAGCTGGCGCAACGCCGGTATGATGAGGCCGGGACGGGCGGTAAATCGCTGGACTCGG
TGATCGGCCGACTGCTGGTCCAGGGGCCGAGCGGCGCACCGCGTCTCTCGCCGGCGGCTGAAAGCCTGCG
CCAGACGCTCAGTGTCTGGACGGCGCGCCGATTCATGCGCTCGGGGGAGACATCGGGCATGACGGCGACG
CCGGCGGCCGGCGCCTCCTGGGACCGCGCGGCTCTGGAGACGATTCCGCCGCTGCTGGAGGATTACCTGC
TGTTCGATGCCAAGGACCTGCCGCAGGCTCCGCAGATCCTGCGTCCATCCATGCGCGCCGCAGCGCAGCA
TCAGCTCCGCCGCGGTGTCGAGCAAATCCTTGCCCGTGCGTTGGCGGGAACCCCTGCCGGCGGCACCATC
GACCGCGCCGGCGGGCTGACCCAGCTCCGGGAATCGGCGCGGTCGCTGCGCCTCGCCTTCCCGGTGCTGG
CCGAAACGATCCAGAACTTCCGGCAGATCGGTCTGGCCACGTCGGCCGACGCCATCCGCGATATCGTCGC
ACGGCAGGCCAACGCCGTGCTCGCCCAGGCCGACCGCATGCTGGAGGAAGACCAGCTCTACCGCCCCGAT
ACCCGCTCGCTGAATGCCTGGATCGACGGGCCGCTGGTTCCCGCCCAGCTGTTCGGCCAGCAGAGCCCGA
CGGCGCTGGCCCTGTATCTCGGCAACGCGCGGCAGGAGGTAACGGCGCTGACCCGCGACGTCGCGGCGCC
GGTCGTCGAAATCCTGGAGAAGCCCGTTATGGGCGGTGGCGAGGGCTCCGGTCTTTCGGCCAAGTGGGCC
CGCATCGTCGCCGAGCTCGACCGCTATGAGGGTGGCCGCCCGAACAGCACGCTGGCCGTCCTGGAGAAGT
TTGTCACCACCGACGTGGCCGCAATCGATGCCGCCAGCTGCCGGGACACGGCGCAGTTCGACGCACTGGC
CAGCGATTTCTTCGCCAGCCGCCTGAACGAGTTGAAGCAATCCATCGCCGACCGCTGCCGCCTGATGGGC
GACCAGCGCGTCTACATGGGCTATGCCGAGATCGCGGCGGCATTCAACGCATCGCTGGCCGGCCGGTTCC
CCTTCGGCCCGATCAGCGACAACCAGGCCGACGTCGCCATGGTGCGGGCCTTCTACGATGCCTTCGACGC
CCGCCAGGGCTCCGTGATCGAGGGGTTGCGCCGTTCCACCCGCCTGGGTACCGCCGGCCATGACGCCCTG
CGATTTATGGAGACGATGGCGATGGCCAAGCCGGCGCTGACGGCGGCCACCGTCACCGACCAGACCGGTG
GCCTGCTGCTCGACCCGACCTTCCGCGTCAACCGCGGCCGGGAGGCCGGCGGCACCAACATCATCGAATG
GAAGCTCTCCACCTCTGCCGGCTCCATCGCCAACATCGGCGCGCGGGCACCGTTGCGCTGGTACCCCGGC
GACCGCGTTGCGGTGTCACTGCGCTGGGCGAAGGACGGCAAGGTCGTGCCGGTGACCGGCATTGGTGCAC
CGTCCGCCGTGGACGACGCCACGCTGACCTTCGCCTACGAGGGGCCCTGGGCGCTGTTCGCGCTGGTCCG
CCAGCACAACGCCGCGCAGCGCGACCGTTCCTCCGGGGCGGATACGGTCCTTCTGTTCGAAGCGCTGACC
AAGGCGGTGCCGGTCGTCGAGGACGCGGATGGCAAGGAGGCCGAGGACAAAGCCAAGCGGGAGGGGCCGC
TGCCTCTGAGTGCCGCCCCGCTCCCCGGCAAGCCGGGGGCGCTTTCCGCGCCCGACGCGCGGAGGGCGGA
TACGCGGGTCTTCATGGCGCTGGGCGCCAAGCGGACCATCGTGACCGAGGGCAAGCCGCCGCGCGACGAG
AAGGTGGCGTTGCTCGAACTTCCGTCGTCGGCGCCGCTACTGCTGTCGGCCGGCGCCATGCCGCGGCCGG
GCTTTCCAGGGGCGCCTCCGGCGGGGCTGACGGGCTTCCCCTCGGCCACCTTCGGCGGTCAGGCGGTCAA
CCCGACGGACCGCGCCTTCTTCGATCTCCAGGCTCCGCCGGGCGTGCCGCCGCTGCTGCGGCCGGCCAAC
CAGCGCGTCTACTGA
 Primer design