SecReT6
Protein ID: 288960245
SecReT6 ID380
T6SS typei1
Gene symbol-
Locus tagAZL_a05100
StrainAzospirillum sp. B510
Repliconplasmid pAB510a [GenBank: NC_013855] [Browse all T6SS(s) in this replicon]
Location [Strand]628099..631734 [-]
Producthypothetical protein
NoteTssM
UniProt IDD3P062
KEGG IDazl:AZL_a05100
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.80E-72, Aligned region: 190..452
IcmF-related [PF06761], Evalue: 5.00E-52, Aligned region: 500..807
DUF1215 [PF06744], Evalue: 7.80E-37, Aligned region: 945..1068
Protein Sequence: 1211 a.a.     [Download]
>gi|288960245|ref|YP_003450585.1| hypothetical protein AZL_a05100 [Azospirillum sp. B510]
MIYFYEFFTRYIGWRWLVRILVIVLLVGAYWFLAPLLEIDGAHPLAEPWARIGLPLGLVALYLVIRLYPS
ARLSWEKRQLARRGITATDSMNSMAVLERLAVMERFEAVAEALGPQAQPGATSADAYTTPWYLMLGPQGG
GRTTLLGRAELDFPLHQPAAGGDDQPCDIWVSRNAVVVDAAGRLALQDSAPEQDEAGWRTLLQMLTRQRP
RRPVNAVLLAVPVDALLADDGRRRQLAETLRRRVQEASSQFGIRMPVYLIITRCDLVAGFSEFFETRDVD
EREQIWGFSLPLERTAAGEAVIRRIETEAALLSERIDAQVPPRLQHERDAARRRLIANFAVQFRLAQQAL
ARFAAEFLRGDHAGAAPPLRGVFLTSATREGFDPALLFGLVAEPFTLDPARVPAPLHPERSFFMANLFAG
AILPEANLAGTNRAVEAGLASRHMLQYGAAGLILAVAGGLWAQAYERHMGRLDLLDGAVQKVALALGQAR
NQPDLTVVFAPLADLQTASTGYRTAGALPTLFDLGMTPDAAIARDLDTIQSALLRREFQPRAAELARQSL
AAALSANDQRAVHHALRVYLMLCTPARADAALLRGWAAQIGQAKFALFPEQNQIFQHHMADLLEVGLDPL
APEEVTVGQARRMLLRSTPAAQVYEELKRVAGTAGLRDFRLPPATLPPSGAAAAGVVSMGSDVLETATVI
PGFYTSEGFYQVFLKQLPNLSNGSVEDDWMFDASSIMAVSATNADLINQVTDLYVRDYVGAWQKLLKSIE
FYGFMSLTEATQTLDYLSAADSPIRNILVSLRNNVDLPVPAPPQPAAGAATAPPVRRAGLTDRLLNAGST
LAAAQLQPEPAAAPPAPPPLPPQLTGANWPGARIAAPFRSLTDLVVENGSRTAGIEGVLGVVSSLAATAK
SVVLSSDPPRAAYQMALARLGVRPGQQADAITLVRMAADRQPEPVRQWLTRLAGETWAAVMNEARASVAQ
SWEQEVMPEWRRSMRDRYPLFREGGAEIPLKDFSTFFGPTGIIDKFVQDRLAAFIDMSGARWTNRQVDGE
SIELSPAALRQLQQAAVIRQAFFAQGSGTAPSVRFSLRPTMLDSRATQLQLVSGGETITYRHEPPRARKL
QWPGEAGFGPLRISVTDVENRSWSLEKDGIWSLYRLLDEARIRPAASGDRYQMDLTLNGLTASFELIAET
AGPNPLDPRLLRDLRLPEHLQ
 
Nucleotide Sequence: 3636 bp     [Download]
>gi|288959735|ref|NC_013855.1|:c631734-628099 Azospirillum sp. B510 plasmid pAB510a, complete sequence
ATGATCTATTTCTACGAATTCTTCACGAGATACATCGGCTGGCGCTGGCTGGTCCGCATCCTGGTGATCG
TCCTTCTGGTCGGCGCCTACTGGTTTCTGGCGCCGCTGCTGGAGATCGACGGCGCCCACCCGTTGGCCGA
GCCGTGGGCGCGCATCGGGCTTCCGCTGGGACTGGTGGCGCTCTATCTGGTGATCCGCCTCTATCCGAGC
GCAAGGCTGAGCTGGGAGAAGCGCCAGCTTGCGCGGCGCGGGATCACCGCCACCGACAGCATGAACAGCA
TGGCGGTGCTGGAACGGCTGGCCGTGATGGAGCGGTTCGAGGCGGTGGCCGAGGCGCTCGGGCCGCAGGC
CCAGCCCGGCGCCACCTCGGCCGATGCCTACACCACCCCCTGGTATCTGATGCTGGGTCCGCAGGGCGGC
GGCCGGACCACGCTGCTTGGCCGCGCCGAACTGGATTTCCCGCTGCACCAGCCCGCCGCCGGGGGTGACG
ACCAGCCCTGCGACATCTGGGTGTCGCGGAACGCCGTGGTGGTCGATGCGGCCGGGCGGCTGGCCCTTCA
GGATTCCGCGCCGGAGCAGGACGAGGCGGGATGGCGGACCCTTTTGCAGATGCTGACCCGCCAACGTCCA
AGACGGCCGGTCAACGCCGTCCTGCTGGCCGTGCCGGTGGACGCGCTGCTGGCCGACGACGGCCGGCGGC
GCCAACTGGCGGAGACGCTGCGCCGTCGGGTCCAGGAGGCATCGAGCCAGTTCGGCATCCGCATGCCGGT
GTATCTGATCATCACCCGCTGCGACCTCGTCGCCGGATTTTCCGAGTTCTTCGAAACCCGCGACGTTGAC
GAGCGCGAGCAGATCTGGGGGTTCTCCCTGCCGCTGGAGCGCACGGCGGCGGGCGAGGCCGTGATCCGCC
GGATCGAAACGGAAGCGGCGCTGCTGAGCGAGCGGATCGATGCACAGGTCCCGCCCCGCCTGCAACACGA
ACGCGACGCCGCCCGTCGCCGTCTGATCGCCAATTTCGCCGTCCAGTTCCGCCTCGCGCAGCAGGCGCTG
GCACGCTTCGCCGCGGAATTCCTGCGCGGCGATCACGCGGGCGCCGCGCCGCCGCTGCGCGGCGTCTTCC
TGACCAGCGCCACGCGGGAGGGGTTCGATCCGGCTCTGCTGTTCGGACTGGTGGCGGAACCCTTCACCCT
CGATCCGGCGCGGGTGCCGGCACCGCTGCACCCCGAGCGCAGCTTCTTCATGGCGAACCTGTTCGCCGGC
GCCATCCTCCCCGAAGCCAACCTCGCGGGCACCAATCGGGCGGTCGAAGCCGGGCTGGCCAGCCGGCACA
TGCTTCAGTATGGCGCCGCCGGCCTGATCCTGGCGGTGGCGGGCGGACTATGGGCGCAGGCCTACGAGCG
TCACATGGGACGTCTGGACCTGCTCGACGGCGCGGTCCAGAAGGTGGCCCTGGCGCTCGGGCAGGCGCGC
AACCAACCGGATCTGACGGTGGTCTTCGCGCCCCTGGCCGATCTTCAGACCGCCTCCACCGGCTATCGGA
CCGCAGGGGCGCTGCCCACCCTGTTCGACCTCGGGATGACGCCGGATGCGGCGATCGCCCGCGACCTCGA
CACGATCCAAAGCGCCTTGCTTCGCCGCGAGTTCCAGCCGCGCGCCGCCGAGCTGGCCCGCCAATCCCTG
GCCGCGGCGCTGAGCGCCAACGATCAGCGCGCGGTGCATCATGCTTTGCGCGTCTATCTGATGCTGTGCA
CGCCGGCCCGGGCCGACGCGGCGCTCCTGCGAGGCTGGGCCGCGCAGATCGGCCAGGCGAAATTCGCCCT
GTTTCCCGAGCAGAACCAAATTTTCCAACATCACATGGCGGATCTTCTCGAGGTTGGGCTCGATCCGCTC
GCCCCGGAGGAGGTGACGGTCGGACAGGCCCGCCGGATGCTGCTGCGGTCGACACCCGCGGCGCAGGTCT
ACGAGGAACTGAAACGGGTGGCGGGCACCGCCGGACTGCGCGACTTCCGCCTGCCGCCGGCGACCCTGCC
CCCCTCCGGCGCCGCGGCGGCGGGTGTCGTCAGCATGGGATCGGACGTGCTGGAAACGGCGACGGTCATT
CCCGGCTTCTACACAAGCGAAGGCTTCTATCAGGTCTTCCTGAAACAGCTTCCCAACCTCAGCAACGGAT
CGGTCGAGGATGACTGGATGTTCGACGCCTCCAGCATCATGGCCGTGTCGGCCACCAATGCCGACCTGAT
CAACCAGGTGACCGACCTCTATGTCCGCGATTATGTCGGAGCATGGCAGAAGCTGCTGAAATCGATCGAG
TTCTATGGATTCATGTCGCTGACCGAGGCGACGCAGACGCTGGACTATCTGTCGGCCGCCGACAGCCCGA
TCCGCAACATCCTGGTTTCGCTTCGCAACAACGTCGACCTGCCGGTGCCCGCCCCGCCGCAGCCGGCGGC
CGGCGCCGCGACCGCTCCGCCGGTGCGCCGCGCCGGTCTGACGGATCGCCTGCTGAACGCCGGAAGCACC
CTCGCGGCGGCGCAGCTCCAACCCGAACCGGCCGCCGCTCCGCCGGCACCGCCGCCGCTGCCGCCTCAAT
TGACCGGCGCCAATTGGCCGGGCGCGCGTATCGCCGCCCCCTTCCGCTCCCTGACCGATCTGGTCGTCGA
AAACGGCTCGCGGACCGCTGGAATCGAAGGGGTGCTGGGGGTGGTGTCCAGTCTCGCCGCCACCGCCAAA
TCGGTCGTGCTGTCCAGTGATCCGCCACGGGCCGCCTACCAGATGGCGCTGGCCCGCCTCGGTGTCCGGC
CGGGACAACAGGCCGACGCCATCACCCTCGTCCGTATGGCCGCCGACCGCCAGCCCGAACCGGTGCGGCA
ATGGCTGACCCGCCTCGCCGGGGAAACCTGGGCCGCCGTGATGAACGAGGCGCGGGCGTCGGTCGCCCAG
TCCTGGGAGCAGGAGGTCATGCCGGAATGGCGGCGCAGCATGCGCGACCGCTATCCGCTGTTCCGCGAGG
GCGGCGCCGAGATTCCCCTGAAGGACTTCTCCACCTTCTTCGGTCCGACCGGGATCATCGACAAGTTCGT
GCAGGACCGGCTGGCCGCCTTCATCGACATGTCGGGCGCCCGCTGGACAAACCGGCAGGTGGATGGCGAG
TCGATCGAGCTGTCGCCCGCTGCCCTGCGTCAATTGCAGCAGGCGGCGGTTATCCGCCAGGCGTTCTTCG
CACAGGGTAGCGGCACGGCGCCGTCGGTGCGCTTCAGCCTTCGCCCGACCATGCTGGACAGCCGGGCCAC
CCAGCTGCAACTGGTCAGCGGTGGCGAGACCATCACCTATCGTCACGAACCGCCGCGTGCACGCAAGCTG
CAATGGCCGGGGGAGGCCGGGTTTGGCCCGCTGCGGATCAGCGTCACCGATGTCGAGAACCGGAGCTGGT
CGCTGGAGAAGGACGGCATATGGTCGCTCTACCGCCTGCTCGACGAGGCGCGCATCCGCCCGGCGGCGAG
CGGTGACCGTTACCAGATGGACCTCACACTGAACGGTCTGACCGCCAGCTTCGAATTGATCGCCGAAACC
GCCGGCCCCAACCCGCTGGACCCCCGGCTGCTGCGCGATCTTCGTCTGCCGGAGCATCTGCAATGA
 Primer design