SecReT6
Protein ID: 28898182
SecReT6 ID43
T6SS typei1
Gene symbol-
Locus tagVP1408
StrainVibrio parahaemolyticus RIMD 2210633
Repliconchromosome I [GenBank: NC_004603] [Browse all T6SS(s) in this replicon]
Location [Strand]1512050..1515439 [-]
ProductIcmF-like protein
NoteTssM
UniProt IDQ87PU3
KEGG IDvpa:VP1408
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.50E-57, Aligned region: 153..411
IcmF-related [PF06761], Evalue: 6.70E-48, Aligned region: 204..231
IcmF-related [PF06761], Evalue: 6.70E-48, Aligned region: 498..755
DUF1215 [PF06744], Evalue: 9.80E-30, Aligned region: 866..987
Protein Sequence: 1129 a.a.     [Download]
>gi|28898182|ref|NP_797787.1| IcmF-like protein [Vibrio parahaemolyticus RIMD 2210633]
MFKQKILRNPVVVSTIVALVLAAIFAAVYLFILEDADKLYLWVGLGVITGFYFTFQLSLWLKKKNSSKVQ
RLETEEEALSMVIRPLLSNAGKKPIYLMVGNKGAGRRQFLFNSSAIKPMDRSRTAKNDFFEWYESDGAVY
VKPDQRLIFQEVSSSDASLWNTFIDEVIRHRPRKPFSGCLFFVDFEFMIVSEPEQKDYIMTALLQRLNSI
TEKTSSALPVYLMMTKLDKLDGFKEYVHSSSLKTRIEFLSIPLKEAKGVLTEYYLDSFHNLVKVLESNAL
DASANSTDINEKQAILAFPKQFELCQREISYVLERLCDTNNGVYSLDIREIFFCSSLQGGRKYNLLAKSC
SNYFNLPIIASEHTQLTETPYFSRFLLDSQILPESDFAGENKTYLRMIQRQSHLAMLASVVLLAGGTYFF
VTTLDSNLRVINQLLNIDEKVQTEQEASFNQLLQSATRAIQPSYNAWLEGSRALDEEVIPLNISRLNEST
KLAYEALIKEVAQQLMPVIEQGYRFELTHNQHDVTATLPLLKGYLMLKDPTKRDIQFLRRQTLQTLTDLS
DKPDVVNQAMRYLDAYFRTQFSPVDINMDVVRATRRSLLANSNVDLVYAGILNQADTIDLGTLDLQRAVG
FEFNNVFNEPLDDNRLVIDKIYTSTGFSTFYRPRVDLMSKQVISDNWVLGLSSYVIPTKEEQESFKNQVR
KKYTDDYINYWRNALSELKIQSYSNVGDLTNAIDLISGPSSPMTTVLKQVYANTQFSPVGEKNVLISKVD
PKLAEVANSASEEVEEVVQPDYLLMKRVEQAFHLLNQLQVSETPNSPTPWDETIAALSRVRTYMKDIADA
PDPQMAALAAAQHRMSSSEADPLIKLKQIAQKSPEPVRSWLLDVVKQSWSVMITESAKGIQTQWYSEIYT
KFKEIGLDKYPFDLTATEEISIEDFELLFASGGLLDTFIQKNFAPFYDTNLWVPKQVDGETMPLSSALLV
QLRNYNVIRDTLINKSTNRVYIPFSAKVLDLDSSAIRASLKISDTDINYYHGPSRIREMEWPPQNGDFNI
SITIQDVTDEGKQHVLNKSGQWAIYRLLGDSTLTNTHNGSFVSDIKVSGRDLSLRITPLTQKNPFTLAEL
YNFTLPESI
 
Nucleotide Sequence: 3390 bp     [Download]
>gi|28896774|ref|NC_004603.1|:c1515439-1512050 Vibrio parahaemolyticus RIMD 2210633 chromosome 1, complete sequence
ATGTTCAAACAAAAAATACTAAGAAATCCAGTCGTGGTTTCTACCATAGTGGCTTTGGTATTAGCCGCGA
TATTTGCAGCGGTATATTTATTCATACTTGAAGACGCAGATAAGCTTTATCTATGGGTTGGTTTAGGAGT
TATTACTGGTTTTTATTTTACATTCCAGCTTTCCCTATGGCTTAAGAAAAAAAACAGCTCAAAAGTTCAA
CGTTTAGAGACGGAAGAAGAAGCTCTTTCAATGGTGATCCGCCCTCTTCTTTCTAATGCGGGCAAAAAGC
CAATCTATCTGATGGTTGGTAATAAAGGGGCCGGTCGACGTCAGTTTTTGTTTAATTCCAGCGCAATTAA
GCCGATGGACCGTTCTCGCACAGCAAAAAACGATTTCTTCGAATGGTATGAATCTGATGGTGCCGTTTAT
GTTAAGCCAGATCAACGCCTCATCTTCCAGGAAGTTTCAAGCAGTGATGCTTCTCTCTGGAATACTTTTA
TTGATGAGGTGATTCGTCATCGTCCGAGAAAACCCTTTTCAGGTTGCTTATTCTTTGTTGATTTCGAATT
CATGATTGTATCTGAGCCAGAGCAGAAAGATTACATCATGACAGCGCTATTGCAGCGTTTGAACTCTATC
ACTGAGAAGACCTCGTCTGCACTACCTGTTTATTTGATGATGACGAAACTCGACAAACTAGATGGCTTTA
AAGAATACGTTCACTCTAGTTCACTAAAAACACGTATTGAATTTCTGTCCATTCCATTGAAGGAAGCGAA
AGGTGTACTTACCGAATACTACCTAGATAGCTTCCATAATCTGGTAAAAGTGCTAGAAAGCAACGCTTTA
GACGCATCGGCAAACTCAACAGATATCAACGAAAAGCAAGCCATCCTTGCCTTCCCAAAACAGTTTGAAC
TCTGTCAACGTGAAATCAGCTACGTGCTTGAACGTCTTTGCGATACAAACAATGGCGTTTACTCGTTGGA
TATTCGCGAAATCTTCTTCTGTTCTTCTTTGCAAGGTGGACGCAAGTACAACTTGTTAGCCAAAAGCTGC
AGTAATTACTTCAATTTACCAATTATCGCATCTGAGCACACGCAACTAACTGAAACACCGTACTTTTCTC
GCTTCTTGCTTGACTCTCAAATCCTCCCAGAGAGTGACTTCGCAGGCGAGAACAAGACTTACCTACGCAT
GATTCAGCGTCAAAGCCATTTGGCAATGCTGGCATCCGTTGTCTTATTGGCAGGCGGTACTTATTTTTTT
GTCACAACACTAGACAGTAACTTGCGTGTTATTAACCAATTGCTGAATATCGACGAAAAAGTTCAAACAG
AACAAGAAGCAAGCTTCAACCAGTTATTGCAGAGTGCTACTCGTGCTATCCAACCCTCATACAATGCTTG
GTTAGAAGGATCACGAGCATTAGATGAAGAAGTAATACCGCTAAATATAAGCAGGTTAAACGAAAGTACA
AAATTAGCGTATGAAGCATTGATTAAAGAGGTTGCTCAACAACTTATGCCTGTTATTGAGCAAGGCTACC
GTTTTGAACTGACACACAACCAACATGATGTCACAGCAACGTTGCCGTTATTAAAAGGCTACTTGATGTT
GAAGGATCCGACCAAGCGAGATATTCAGTTTTTACGACGCCAAACATTGCAAACACTGACAGACTTGAGC
GATAAGCCGGATGTGGTAAATCAAGCTATGCGATACTTGGACGCCTACTTCCGCACTCAATTCTCACCTG
TAGATATCAACATGGATGTCGTTCGAGCAACTCGTCGCTCATTGTTGGCAAATTCAAATGTGGATCTTGT
TTACGCAGGCATTTTAAACCAAGCAGATACTATCGATCTTGGCACACTCGATCTACAACGTGCAGTTGGC
TTTGAATTTAACAACGTATTTAACGAGCCGTTAGATGACAACCGACTAGTAATCGATAAGATCTATACCT
CCACTGGCTTTAGTACCTTCTATCGCCCTCGCGTCGACTTGATGTCTAAACAAGTGATCAGTGATAACTG
GGTGCTAGGATTGTCCAGCTATGTTATCCCAACCAAAGAAGAGCAAGAATCGTTTAAAAATCAAGTACGT
AAAAAGTACACCGATGATTATATCAACTACTGGCGCAACGCTCTCAGTGAGTTAAAAATTCAGAGTTATA
GCAATGTGGGTGATCTAACAAATGCTATCGACCTAATCTCTGGACCATCTTCACCAATGACGACTGTATT
AAAGCAGGTCTATGCAAATACTCAGTTTTCACCGGTAGGAGAAAAAAACGTACTCATCTCGAAAGTAGAC
CCAAAACTGGCAGAAGTGGCGAACTCTGCGTCAGAAGAGGTTGAAGAAGTGGTTCAGCCGGATTACTTGT
TGATGAAGCGTGTAGAACAAGCGTTCCATCTTCTAAATCAGCTTCAAGTAAGCGAGACTCCTAACTCCCC
TACTCCATGGGACGAAACTATCGCAGCTTTAAGCCGAGTTCGCACCTACATGAAAGATATTGCGGATGCT
CCCGATCCACAAATGGCAGCACTTGCAGCCGCTCAACACCGAATGAGCAGCTCTGAAGCCGATCCGCTAA
TTAAACTTAAACAGATTGCTCAGAAGTCACCAGAGCCAGTACGCAGTTGGTTACTTGATGTCGTAAAGCA
AAGCTGGTCGGTAATGATCACCGAATCAGCAAAAGGCATTCAAACCCAATGGTATAGTGAAATTTACACC
AAATTTAAAGAGATAGGACTTGATAAATACCCATTTGATCTCACAGCAACAGAGGAGATTTCTATCGAAG
ACTTCGAACTGTTGTTTGCTTCAGGTGGATTGTTAGACACATTTATTCAGAAAAACTTCGCACCGTTCTA
CGATACCAACTTGTGGGTACCAAAACAGGTGGATGGTGAAACAATGCCATTATCTTCAGCCTTACTGGTG
CAATTGCGCAATTACAACGTTATCCGCGACACGCTGATCAATAAGAGTACTAACCGAGTTTATATTCCAT
TCAGTGCGAAAGTATTAGATCTTGACTCAAGTGCTATCAGAGCCAGTTTGAAAATCTCTGACACTGATAT
CAACTACTATCACGGTCCGAGCCGAATTCGTGAAATGGAGTGGCCACCGCAAAACGGCGACTTCAACATT
AGTATCACGATCCAAGATGTGACAGACGAAGGTAAACAACACGTTTTAAATAAGAGTGGTCAATGGGCGA
TATATAGATTGCTAGGTGATTCGACCCTGACAAACACTCATAACGGTAGCTTCGTTAGTGACATAAAAGT
ATCAGGGAGGGATTTGAGCCTCCGTATAACTCCCTTGACACAAAAAAACCCTTTCACTTTGGCTGAGTTG
TACAACTTTACGCTCCCAGAGTCGATTTGA
 Primer design