SecReT6
Protein ID: 28900894
SecReT6 ID44
T6SS typei5
Gene symbol-
Locus tagVPA1039
StrainVibrio parahaemolyticus RIMD 2210633
Repliconchromosome II [GenBank: NC_004605] [Browse all T6SS(s) in this replicon]
Location [Strand]1095070..1098588 [-]
Producthypothetical protein
NoteTssM
UniProt IDQ87HC6
KEGG IDvpa:VPA1039
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 2.40E-87, Aligned region: 502..805
ImcF-related_N [PF14331], Evalue: 4.80E-86, Aligned region: 190..452
DUF1215 [PF06744], Evalue: 1.70E-38, Aligned region: 919..1034
AAA_19 [PF13245], Evalue: 0.0059, Aligned region: 127..142
AAA_16 [PF13191], Evalue: 0.0059, Aligned region: 40..115
AAA_16 [PF13191], Evalue: 0.0059, Aligned region: 125..192
Protein Sequence: 1172 a.a.     [Download]
>gi|28900894|ref|NP_800549.1| hypothetical protein VPA1039 [Vibrio parahaemolyticus RIMD 2210633]
MSIKEIGRVFTQRWFLGLVGVAACSIFIWVVGPLITVAGYEPLKSDFQRLVTILVIVFAWALINLTKQHK
QKVREDESIQTLLEVDSQSDKEAASEIDVMRDRIEQAIKVVTKTHKGKRSLYDLPWYVLIGPPGTGKTTV
LKQSGLEFPLTESLGADSIAGVGGTRHCDWWFANKAVLIDTAGRYTTQDSQEKVDSKAWHGFLGLLKKYR
TQRPINGAIVTVSLASVMSQTRTERSLHARSIKSRLQELKNQLGMQFPIYVLLTKMDLVAGFNEFFADLS
KEEREELFGFMFPREVDDERGVISLFNKEFHGMLERLDAHMLRILETEDDLEKRTLIFEFPKQLRVLQAN
LDEFLSEIFAQNTFEEPALIRGVFLLSSVQEGIPVDRLMSESTNGLGLGRLPLATNVNSSHSYFVKNLFE
RVIFKEQLLGTVNRHYQKQSGWMRTGIYVGCVGVLVGASALWFLSYQWNSKLIVDTNSQVNHIEAMIGAE
SLDFESDVISAVDTLDKIMMLPLGKNSKYGHSDAVKKFGLYQGDKVSQAANNAYSDALSQHFATLLSESL
VSEMEANKQHREYLYETLKTYLMLFNPEKYQQEEVIAWFNFYFERQYPGELNKELRERLLVHTKNLLEND
EKGFSMDATAISAAREVLTQMSLPERAYQRMKMQFAKSHVPSFRLTDVLGPKGLEQFERASGKPLSQGIS
GFYTYNGFHSIFQIQINRTVKGLMEENWVYGDDLKAHEIDHDSAIQGVQARYYQDYVNEWKTLIEDIQLK
QAPSLALATEQSRVLSGVERPIESLLRAIQKEVGLSKVTLSENQKAATEVAGKVAKVKFSNTADKLDMYL
PEENGFNVALPGKEVESHFTEILRLSEQDFDDIQQAMVNLRSYLSDLSSSGNNQKIAYKSILDGTVTQDV
AASFARAKDLLPKPFNQWLGELSQESVKFAESGSKDHLNQLWMTNVVRPYQRTIAGRYPFEPNATKEVRL
KDFQRFFGYGGTLDSFFQEYLEPFVDTSKSRWRLEKEIGVRPETLAVFQRAKRIRQSFFESDNSLRVEFG
MKPVYLDQHITRFVLELGDQDLVYKHGPARSKELRWPSGQDQTRIVFTPPESKREIAHTYEGEWGIFKLL
DQSLKARPESRNDNIVMIDLKGNKVQLELIPSSAINPFWSNEMERFRCPQTL
 
Nucleotide Sequence: 3519 bp     [Download]
>gi|28899855|ref|NC_004605.1|:c1098588-1095070 Vibrio parahaemolyticus RIMD 2210633 chromosome 2, complete sequence
ATGAGTATTAAAGAAATAGGCAGAGTATTTACCCAAAGATGGTTTCTTGGTTTAGTCGGTGTAGCCGCGT
GCTCCATTTTTATTTGGGTTGTGGGTCCTCTGATCACGGTTGCAGGTTACGAGCCGCTTAAAAGTGATTT
TCAACGTTTAGTTACGATCTTAGTGATTGTTTTTGCTTGGGCGCTTATCAACTTAACAAAGCAGCACAAA
CAGAAAGTTAGAGAAGACGAAAGTATTCAGACGTTGCTTGAAGTAGACAGCCAATCAGACAAAGAAGCCG
CCAGTGAAATTGACGTAATGCGCGATCGTATAGAGCAAGCGATCAAAGTTGTGACAAAAACGCATAAAGG
AAAGCGTAGTTTGTACGATTTACCTTGGTACGTTCTGATTGGTCCTCCTGGAACAGGTAAAACCACGGTT
CTAAAGCAATCTGGCTTGGAATTTCCGTTAACTGAGAGCTTAGGAGCTGACTCTATAGCTGGTGTAGGTG
GAACACGTCACTGTGATTGGTGGTTTGCTAATAAAGCAGTACTTATTGATACAGCAGGACGTTACACCAC
GCAAGATAGTCAAGAAAAGGTTGACTCTAAAGCTTGGCACGGTTTCTTAGGGTTGCTTAAGAAATACCGC
ACTCAAAGGCCTATCAATGGCGCTATCGTAACAGTCAGCCTAGCAAGTGTGATGTCTCAAACTCGTACGG
AGCGTAGCTTACATGCCAGATCAATAAAATCTCGCCTTCAGGAACTCAAAAATCAGTTGGGTATGCAATT
CCCAATCTATGTTCTGCTGACGAAAATGGATCTGGTTGCTGGCTTTAATGAATTTTTTGCTGATTTAAGT
AAAGAAGAGCGTGAGGAACTTTTTGGATTTATGTTCCCACGAGAAGTTGATGACGAACGTGGTGTTATTT
CTCTATTCAATAAAGAGTTTCACGGCATGTTGGAGCGGCTCGATGCGCACATGTTACGTATATTAGAAAC
TGAAGATGACTTAGAAAAGCGCACGCTAATATTCGAATTTCCAAAACAGCTGCGAGTTTTACAAGCAAAC
TTAGATGAGTTTTTGTCTGAGATATTTGCGCAGAACACGTTTGAAGAGCCAGCCCTTATTCGCGGTGTTT
TCTTGCTTAGCTCTGTACAAGAAGGTATTCCTGTTGATCGACTGATGAGTGAATCAACTAATGGATTGGG
ACTAGGGAGGTTGCCTTTAGCGACAAACGTTAACAGTTCGCATAGCTATTTTGTTAAAAATCTTTTTGAG
CGAGTCATCTTTAAAGAGCAATTACTAGGTACTGTTAACCGCCACTATCAAAAGCAATCTGGATGGATGC
GTACGGGCATATACGTGGGTTGTGTTGGTGTTCTTGTTGGTGCTTCTGCTCTTTGGTTCCTGAGTTATCA
ATGGAATTCAAAGTTAATTGTCGATACCAATAGCCAAGTAAATCATATTGAAGCGATGATAGGTGCAGAG
AGCCTTGATTTTGAATCGGACGTTATCAGTGCTGTAGACACGTTAGACAAGATCATGATGTTGCCACTAG
GGAAAAATAGTAAATATGGTCATTCTGATGCAGTGAAAAAGTTTGGTCTGTATCAAGGTGACAAAGTTTC
TCAAGCAGCAAATAACGCGTATTCAGATGCTCTTTCTCAACACTTTGCTACTCTGCTGTCAGAGAGTTTG
GTCTCGGAAATGGAAGCGAATAAGCAGCATCGTGAATACTTATACGAGACGTTAAAGACGTATTTAATGT
TGTTTAATCCGGAAAAGTATCAACAAGAAGAGGTAATTGCTTGGTTCAACTTCTACTTTGAACGTCAGTA
TCCAGGAGAGTTAAACAAAGAGCTACGTGAGCGTTTGCTAGTGCATACTAAAAACTTACTAGAGAACGAC
GAGAAAGGCTTCTCAATGGATGCGACTGCTATTAGTGCAGCACGAGAAGTTCTAACGCAAATGTCACTTC
CAGAGCGTGCATATCAGCGTATGAAGATGCAGTTTGCTAAAAGCCACGTTCCGTCTTTCCGTTTAACAGA
CGTGTTAGGACCTAAAGGTTTAGAACAATTTGAGCGAGCAAGTGGAAAACCTCTATCGCAAGGTATTTCC
GGTTTTTATACCTACAACGGTTTTCACAGCATTTTCCAAATTCAGATTAATCGCACTGTCAAAGGATTGA
TGGAAGAAAACTGGGTGTATGGGGATGATCTTAAAGCTCATGAAATTGATCATGATAGTGCTATTCAGGG
GGTTCAAGCCCGCTATTATCAAGATTATGTCAATGAGTGGAAAACTCTGATAGAGGATATTCAGCTTAAA
CAAGCTCCAAGTTTGGCTTTAGCAACAGAGCAATCAAGAGTTTTATCCGGTGTAGAAAGACCAATTGAAT
CACTTCTGCGTGCAATACAAAAGGAAGTGGGGTTATCGAAAGTAACGTTATCGGAAAATCAAAAGGCAGC
AACGGAAGTCGCAGGAAAGGTTGCAAAAGTGAAGTTTTCTAATACGGCAGACAAACTCGATATGTATTTG
CCTGAAGAGAATGGATTTAATGTTGCTCTACCAGGTAAAGAAGTTGAATCCCATTTCACCGAAATCTTAC
GACTTAGTGAACAAGACTTTGATGATATTCAGCAAGCGATGGTGAATTTGCGTTCGTACTTATCTGATTT
GTCTAGCTCTGGCAACAATCAAAAAATTGCTTACAAAAGCATATTGGATGGAACGGTAACTCAGGATGTT
GCTGCCTCCTTTGCTAGAGCAAAAGATCTCTTACCAAAACCGTTTAATCAATGGTTGGGAGAGTTGTCAC
AGGAATCGGTTAAGTTTGCAGAAAGCGGCTCTAAAGATCATCTAAATCAACTTTGGATGACTAATGTAGT
GCGTCCTTATCAGCGGACTATAGCAGGTAGATACCCATTTGAACCTAATGCAACGAAGGAAGTTCGTCTA
AAGGACTTTCAACGATTCTTCGGGTACGGTGGTACGTTGGACTCGTTCTTCCAAGAATATCTGGAGCCGT
TTGTTGATACGTCTAAGAGTCGTTGGAGACTAGAAAAAGAAATCGGTGTAAGGCCCGAGACGCTTGCGGT
TTTTCAAAGGGCAAAACGCATTAGACAATCGTTCTTTGAATCAGATAACTCGCTACGAGTCGAGTTTGGT
ATGAAACCCGTATATCTAGATCAACACATTACTCGATTTGTTCTAGAGCTAGGTGATCAAGACTTGGTTT
ATAAGCACGGTCCTGCGAGATCGAAGGAACTTCGCTGGCCATCGGGTCAAGATCAGACGCGTATTGTGTT
TACACCGCCCGAATCAAAACGAGAAATTGCTCATACCTATGAAGGGGAATGGGGCATTTTCAAACTATTG
GACCAATCACTCAAGGCTCGACCAGAGTCCCGCAACGACAACATTGTCATGATCGATTTGAAGGGGAACA
AGGTTCAGCTTGAGTTGATTCCATCTAGTGCGATCAACCCATTTTGGTCTAATGAGATGGAGAGGTTCAG
ATGTCCGCAAACCTTGTAA
 Primer design