SecReT6
Protein ID: 290473359
SecReT6 ID381
T6SS typei1
Gene symbol-
Locus tagXBJ1_0276
StrainXenorhabdus bovienii SS-2004
Repliconchromosome [GenBank: NC_013892] [Browse all T6SS(s) in this replicon]
Location [Strand]284932..288501 [+]
Producthypothetical protein
NoteTssM
UniProt IDD3UYP9
KEGG IDxbo:XBJ1_0276
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 9.20E-81, Aligned region: 518..833
ImcF-related_N [PF14331], Evalue: 2.00E-70, Aligned region: 211..471
DUF1215 [PF06744], Evalue: 7.20E-36, Aligned region: 318..334
DUF1215 [PF06744], Evalue: 7.20E-36, Aligned region: 727..755
DUF1215 [PF06744], Evalue: 7.20E-36, Aligned region: 928..1047
Miro [PF08477], Evalue: 0.0031, Aligned region: 144..286
Miro [PF08477], Evalue: 0.0031, Aligned region: 771..813
Protein Sequence: 1189 a.a.     [Download]
>gi|290473359|ref|YP_003466225.1| unnamed protein product [Xenorhabdus bovienii SS-2004]
MKWPSLSSLAPLKSALPALSKFKSLPRLKATMALALALIPCLLLIAVWVWGPEWKLRNDTPLDSLAARWL
ATALIILMVLLWIGIKAWRRLRQLEKLNLDVELKGVDPVRVDIEHQARYLDHWKAQLQRHLDSYNYLYQR
PWYMMVGSQQSGKTTLIKEGYKLSDIAAPEYLRQDGDIALRLRCWLGEKAVIIDPDGGLIDQPVPVNSDK
PQINSRLWESLLNWLTENRQRQPLNGIILTVDTLRLLTDNREQRDRYVREIHQRLQNLRLTFHSQLPLYL
VMTKIDLLHGFEAMYPSLDRRQRDQILGVTFSLNNRDEKAWHSELAQFWQQWMANLNGAMPDMMLNGVDA
GQRSALFSFTRQVQGLHSYIAQMLEDILYNDEHHRPMLRGVYLTSARQVGQMDDLFTQSASAQYHLGSQA
FPTWPAGDTLPYFTQSLFEEVLLAEPNLAAENRLWLSRNRRQLYTFATISALVIAAMWGGWHYFYQKNYR
AGEEVLAQAKNFLSVPPPDGDDRYGNLQLPLLNPIRDATLAYGNYHEKKSFLTDMALYQGDGVGPYVEGT
YLKLLEQRFLPSLMQGLLDDLNRAPAGSEEKLEILRVMRMMEDGSKRNNGLVGQYMRARWSKAFHGQRDL
QAQLLTHLDYALAHTDWKGQRDKDNQDALARFAPFIKPMKQAQQELSALTINQRVYQNLRLKAQDTLSAP
VNLRDQIGPSFDSVFIAGNESRLVIPQFLTRHGLTDYFVRQDKELVELTEMDSWVLNLPLKTNKYSDTDQ
GNIQREITELYVGDYTATWRAAMNNLEVRDFEDLPQAISAIEQVISGEQPIKRALQILSDNTRPPELVSG
LSDKEKQALLAQSDYRLLNRISRDFAPETGVLVEHGDKGSALQSVYQKLMALHRYLLAIQNSPVPGKAAL
QAVQLRLDQNNSDAIFEVQQMAKNLPEPLNRWVGDLAEQAWRVVMMEAVRSLEVEWNESVVKQYKTYLAG
RYPFNPAATEDVPLSEFDRFFRPDGTLDTFYKQSLKPFVENNLTTGTDGRELIRADVLKQLAMADRIRTT
FFTPQNGLGTAFAIEPVSLTGNKRRGLLNLDGQLVDYAHGRSNVAHLVWPNSMRAGTESRLTLMPDRSNA
APRSLSFTGPWAQLRLINSGKLTNVQPGAFDVRFAVDGGEITYRIYVDESDNPFAGGLFSQFRLPDTLY
 
Nucleotide Sequence: 3570 bp     [Download]
>gi|290473094|ref|NC_013892.1|:284932-288501 Xenorhabdus bovienii SS-2004 chromosome, complete genome
ATGAAATGGCCCTCTTTGTCATCCTTGGCGCCGTTGAAATCAGCCTTGCCGGCGCTGTCAAAATTTAAAT
CCCTGCCGCGTCTCAAGGCCACGATGGCGCTGGCTCTGGCCCTTATCCCCTGCCTGCTGCTGATCGCGGT
CTGGGTGTGGGGGCCGGAATGGAAACTGCGCAACGATACCCCGCTGGACAGTCTGGCGGCGCGCTGGCTG
GCGACCGCTCTCATCATCCTGATGGTGCTGCTCTGGATCGGCATCAAAGCGTGGCGTCGCCTGCGCCAGC
TGGAAAAACTCAACCTGGACGTCGAGCTGAAAGGGGTTGATCCGGTGCGGGTCGATATCGAGCACCAGGC
TCGTTACCTTGATCACTGGAAAGCCCAGCTACAACGCCATCTGGACAGCTATAACTACCTGTATCAGCGT
CCGTGGTACATGATGGTCGGCAGCCAGCAGAGCGGCAAAACCACGCTGATCAAGGAAGGCTATAAACTGT
CCGACATCGCGGCGCCGGAATACCTGCGTCAGGATGGCGACATTGCGCTGCGGCTGCGCTGCTGGCTGGG
AGAGAAAGCGGTCATCATCGATCCCGATGGCGGCCTGATTGACCAGCCGGTGCCGGTCAACAGTGACAAA
CCGCAGATCAACAGCCGCCTGTGGGAATCCCTGCTGAACTGGCTGACGGAAAACCGCCAGCGCCAGCCGC
TTAACGGCATTATTCTGACCGTCGATACCCTGCGCCTGCTGACCGACAACCGGGAGCAACGCGATCGCTA
CGTGCGGGAAATCCACCAGCGCCTGCAAAACCTCCGTCTGACCTTCCACAGCCAGCTGCCGCTCTATCTG
GTCATGACCAAAATAGACCTGCTGCACGGCTTCGAAGCGATGTACCCGTCGCTGGATCGCCGGCAGCGTG
ACCAGATCCTCGGCGTGACTTTCAGCCTCAATAACCGGGATGAAAAAGCCTGGCACAGCGAGCTGGCGCA
GTTCTGGCAGCAGTGGATGGCCAACCTCAACGGGGCGATGCCGGACATGATGCTCAACGGCGTCGATGCC
GGCCAGCGCAGCGCTCTGTTCAGCTTTACCCGGCAGGTGCAGGGGCTGCACAGCTATATCGCGCAGATGC
TGGAAGACATCCTGTACAACGATGAACACCACCGCCCGATGCTGCGCGGTGTCTACCTGACCTCCGCCCG
TCAGGTCGGCCAGATGGATGACTTGTTCACCCAGTCCGCCTCAGCCCAGTATCACCTCGGCTCGCAGGCG
TTCCCGACCTGGCCGGCGGGCGATACCCTGCCGTATTTTACCCAGTCCCTGTTTGAGGAAGTGCTGCTGG
CTGAGCCGAACCTCGCCGCGGAAAACCGCCTCTGGCTGAGCCGCAACCGCCGCCAGCTGTACACCTTCGC
CACGATCAGTGCCTTAGTCATCGCGGCCATGTGGGGCGGCTGGCATTATTTCTACCAGAAAAACTACCGG
GCCGGGGAAGAAGTGCTGGCGCAGGCGAAAAACTTCCTGTCCGTGCCGCCGCCGGACGGGGATGACCGTT
ACGGCAACCTCCAGCTGCCGCTGCTGAACCCGATCCGGGATGCCACTCTGGCCTACGGCAACTACCACGA
GAAAAAATCCTTCCTGACCGACATGGCGCTGTATCAGGGGGACGGGGTCGGGCCGTATGTGGAAGGCACC
TACCTGAAACTGCTGGAGCAGCGTTTCCTGCCGTCGCTGATGCAGGGGCTGCTGGACGACCTGAATCGGG
CGCCGGCCGGCAGTGAGGAAAAACTCGAGATCCTGCGGGTGATGCGCATGATGGAAGACGGCAGCAAGCG
TAACAACGGCTTGGTCGGGCAGTACATGCGGGCGCGCTGGAGCAAGGCGTTCCACGGCCAGCGGGATTTA
CAGGCGCAGCTGCTGACCCATCTGGATTACGCTCTGGCCCATACCGACTGGAAGGGGCAGCGCGACAAGG
ACAATCAGGATGCCCTCGCCCGCTTTGCGCCGTTTATTAAGCCGATGAAGCAGGCCCAGCAGGAGCTGAG
TGCCCTGACCATCAACCAGCGGGTTTACCAGAACCTGCGCCTGAAGGCCCAGGATACCCTGTCCGCCCCG
GTTAACCTGCGTGACCAGATTGGGCCGAGTTTTGACAGCGTGTTTATTGCCGGCAACGAAAGCCGGCTGG
TGATCCCGCAGTTCCTGACCCGCCACGGCCTGACGGATTACTTTGTCCGGCAGGACAAGGAGCTGGTCGA
ACTGACCGAGATGGACAGCTGGGTGCTGAACCTGCCGCTGAAAACCAATAAGTACAGCGACACCGATCAG
GGGAATATCCAGCGTGAGATCACCGAACTGTATGTCGGGGATTATACCGCGACCTGGCGGGCGGCGATGA
ACAATCTGGAAGTGCGGGACTTTGAGGATCTGCCGCAGGCCATCAGCGCCATCGAGCAGGTGATCAGCGG
CGAACAGCCGATCAAGCGCGCGCTGCAAATCCTCAGTGACAACACCCGGCCGCCGGAGCTGGTGAGTGGG
CTGAGCGACAAGGAAAAACAGGCGCTGCTGGCGCAGTCGGATTACCGGCTGTTAAACCGCATCAGCCGGG
ACTTTGCGCCGGAAACCGGGGTGCTGGTTGAGCACGGCGACAAGGGCAGTGCCCTGCAAAGCGTTTACCA
GAAACTGATGGCACTGCACCGTTACCTGCTGGCTATCCAGAACTCGCCGGTGCCGGGCAAGGCGGCATTG
CAGGCGGTGCAGCTGCGGCTGGACCAGAACAACAGCGACGCGATATTTGAAGTGCAGCAGATGGCGAAAA
ACCTGCCGGAGCCGCTGAACCGCTGGGTCGGTGATCTGGCCGAGCAGGCGTGGCGGGTGGTGATGATGGA
AGCGGTGCGCTCGCTGGAAGTGGAATGGAATGAGTCGGTGGTCAAACAGTATAAAACCTACCTGGCCGGC
CGGTATCCGTTCAACCCGGCGGCCACCGAAGACGTACCGCTGAGTGAGTTTGACCGTTTCTTCCGGCCGG
ACGGCACGCTGGATACCTTCTATAAGCAGAGCCTGAAACCGTTCGTGGAAAACAACCTGACCACCGGCAC
CGACGGGCGTGAGCTTATCCGGGCGGATGTGCTGAAACAGCTGGCGATGGCGGACCGTATCCGCACCACC
TTCTTCACCCCGCAGAACGGGCTGGGCACGGCGTTTGCCATCGAGCCGGTGAGCCTGACCGGCAACAAAC
GCCGCGGTCTGCTGAACCTCGACGGCCAGCTGGTGGATTACGCGCACGGGCGCAGCAACGTGGCGCATCT
GGTGTGGCCGAACTCGATGCGGGCGGGCACGGAAAGCCGGCTGACCCTGATGCCGGACCGGAGCAACGCG
GCGCCGCGCAGCCTGAGCTTCACCGGCCCGTGGGCGCAGCTGCGGCTGATTAACAGCGGCAAGCTGACCA
ACGTGCAGCCGGGGGCGTTTGACGTGCGCTTCGCGGTAGACGGCGGCGAGATAACCTACCGCATTTACGT
GGACGAATCGGACAACCCGTTTGCGGGCGGCCTGTTCAGCCAGTTCAGACTGCCGGACACCCTCTACTGA
 Primer design