SecReT6
Protein ID: 290475120
SecReT6 ID382
T6SS typei3
Gene symbol-
Locus tagXBJ1_2105
StrainXenorhabdus bovienii SS-2004
Repliconchromosome [GenBank: NC_013892] [Browse all T6SS(s) in this replicon]
Location [Strand]2065703..2069218 [-]
Producthypothetical protein
NoteTssM
UniProt IDD3V3B6
KEGG IDxbo:XBJ1_2105
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.70E-73, Aligned region: 205..395
ImcF-related_N [PF14331], Evalue: 1.70E-73, Aligned region: 398..440
IcmF-related [PF06761], Evalue: 8.00E-70, Aligned region: 489..796
IcmF-related [PF06761], Evalue: 8.00E-70, Aligned region: 872..909
DUF1215 [PF06744], Evalue: 1.20E-25, Aligned region: 314..335
DUF1215 [PF06744], Evalue: 1.20E-25, Aligned region: 900..1028
MMR_HSR1 [PF01926], Evalue: 5.70E-05, Aligned region: 142..244
Protein Sequence: 1171 a.a.     [Download]
>gi|290475120|ref|YP_003468004.1| unnamed protein product [Xenorhabdus bovienii SS-2004]
MLSAIVAIFTSRLMWSFLGITAISSIIWFIGPMTSIGNTIPLGSSTVRIIIIAILYFVWLFIQLASHLYQ
VWLNKKLSAPLNRGNDEGEQVRNSQYSPLSEHFSDALRLLKNAYFYGSEIQYKPKWKPFFDRRYRYQLPW
YVLIGPPNSGKTTLLANSGLHFPLSDHFETLSSNEIKETDNCHWWFTNQAVLLDTPGRYTTQDTRHEQDA
REWKCFVNLLKKYRTRQPLNGVILTISVADLLNPSKKVRDQHAYLLRRRLSELQAQFKIQFPIYVIITKI
DLLKGFGAYFAHFDKTQRDQIWGFNFPWNKTGWDLKDIFAQQYGLLQTRLNAELSHILLHLNDLQQCAES
YLFPQEFAALQPLIAQHLEIAFAKSGFDIPYSPRGLYFTSSVQEEPIHQGYFLKTLLETLFQEAGLAGQN
RWWVYRNRLLKGLGYIILAAIMGLIITLFFSSYGNNKNYLTEVQNKIFPILSQSAALKKISNDIDIYALL
PILNKVADLGKSKYFSPDAPPWSYQMGLYHGEQINDASLTLYTKTLQTLLLPQVARLITSQLHQTNSDNI
YNTYNTLKAYQMLCQPQHYDGKFLHRWVMQYLQAHLPPTISPTQLHQIEGHLRQLLEYQIVTFPYVCDNP
LIKQKQILLSKIPLAQLVYIHLKQELSDNPNLSPVGLTTLAGPEAGLVFSRINGTPITLNIAGMFTPAGY
QMGIGNNLTTLIDKLYSQNAWILGQYAEISTPRELTLLVRQFYLHDYLEQWDKFLFDIRLNNIDSLEQRS
NIAQFLASNASPMRNLLINISKNVNLDERLSDNHFDKKIGELVSRKADSLTKVVPNPFMSGDNLPTPEQE
LRKHFAQITALANNPDGKNKQIPFDHVLSQLAKLHEYLDSVQNATNIGIPAPSDEIITQLQATAERLPIP
FKGIISSLAMGANSDTQASNVKNLNKQLNTEVQGFCHQAIANRYPLTPWALDDIRPDDMARMFAPQTGIM
DSFFQKNLVGKVDTSHENWRLILGTDSKAKALPESHKLLLPFQQAQIIRDTLFSDGSRIPSFRVIVRTVN
MDKEILSMILDVDGQQLQYSHGPQVSQSLNWPGPNGSNQARIQLNLDDGTTASLITSGPWALNRLIDHEQ
FAAGKPATNNHTSQRVTFNIRGHHVSLEFIPNSILSPFQLPIFVCPKLINS
 
Nucleotide Sequence: 3516 bp     [Download]
>gi|290473094|ref|NC_013892.1|:c2069218-2065703 Xenorhabdus bovienii SS-2004 chromosome, complete genome
ATGTTGAGCGCCATTGTTGCTATTTTTACCAGCCGATTAATGTGGAGTTTCCTCGGCATCACCGCCATCT
CTTCCATTATCTGGTTTATTGGTCCCATGACTTCTATCGGTAATACCATACCTCTTGGATCAAGTACGGT
ACGAATAATTATCATTGCCATATTATATTTTGTCTGGCTCTTTATCCAGTTAGCGTCTCACTTATATCAG
GTTTGGCTGAATAAAAAACTTTCTGCCCCATTAAACAGAGGCAATGACGAGGGTGAACAAGTACGAAATT
CACAATATTCCCCTTTATCAGAACACTTTTCTGATGCCTTACGACTACTGAAAAATGCCTATTTTTATGG
TTCAGAGATCCAATATAAGCCAAAATGGAAACCTTTTTTCGATCGTCGATATCGGTATCAGTTACCTTGG
TATGTCCTGATTGGCCCCCCCAATTCAGGGAAAACAACCCTTCTGGCAAATTCTGGTTTGCACTTTCCAT
TATCCGATCATTTCGAAACGCTTTCCTCAAACGAGATAAAAGAAACCGATAATTGTCACTGGTGGTTCAC
CAATCAGGCTGTCTTACTGGATACACCCGGACGATATACCACTCAGGATACACGGCACGAACAAGATGCC
CGTGAATGGAAATGTTTTGTCAATTTGCTGAAAAAATATCGCACACGCCAGCCCCTAAATGGCGTCATTC
TTACCATTAGCGTAGCGGATTTATTAAACCCCTCAAAGAAAGTACGTGATCAACACGCTTATTTATTACG
CAGGCGATTGTCAGAATTACAGGCTCAGTTCAAGATCCAATTTCCAATCTATGTCATCATTACCAAGATT
GATTTACTGAAAGGATTTGGGGCTTATTTTGCCCATTTTGACAAAACACAGCGCGATCAAATCTGGGGAT
TCAATTTCCCGTGGAACAAAACAGGCTGGGATCTGAAGGACATTTTTGCACAGCAATATGGGTTGTTGCA
GACACGATTAAATGCAGAGCTATCCCATATTTTATTGCACCTGAATGATCTTCAGCAATGTGCTGAAAGT
TACCTGTTTCCGCAAGAATTTGCCGCACTGCAACCCTTAATTGCTCAGCATCTTGAAATTGCATTCGCTA
AATCAGGGTTTGATATTCCTTATTCACCACGTGGGCTTTATTTCACTAGCAGCGTACAGGAAGAGCCTAT
TCATCAAGGATATTTTCTGAAAACTCTGCTGGAAACGCTCTTTCAGGAAGCGGGGCTTGCCGGTCAAAAT
CGTTGGTGGGTGTACAGAAACCGTCTATTAAAAGGGCTGGGGTATATTATTCTGGCTGCGATCATGGGGT
TAATCATCACCTTGTTTTTTAGCAGTTATGGCAACAATAAAAATTACCTGACAGAAGTTCAAAATAAAAT
TTTCCCTATTCTGAGCCAAAGTGCAGCATTAAAAAAGATCAGCAACGACATCGATATTTATGCCTTACTG
CCTATTTTGAATAAAGTGGCGGATTTGGGAAAAAGTAAATATTTTTCTCCTGATGCTCCCCCTTGGTCAT
ACCAAATGGGCTTGTATCATGGTGAACAGATCAATGATGCCAGTTTGACTCTGTACACGAAAACATTACA
AACCTTATTGCTACCGCAAGTCGCACGGTTAATAACGTCTCAATTGCACCAAACCAACAGCGATAATATA
TATAACACTTACAATACGTTGAAAGCGTATCAAATGTTATGTCAGCCCCAACATTATGACGGTAAGTTCT
TACATCGTTGGGTGATGCAATATTTGCAGGCTCATTTACCCCCCACTATTTCACCGACACAATTACACCA
AATTGAGGGGCATCTGCGCCAATTATTGGAATATCAGATCGTTACTTTCCCTTATGTTTGTGATAACCCA
CTGATAAAACAAAAACAGATTTTACTTAGCAAGATCCCACTAGCACAACTCGTTTATATCCATTTAAAAC
AGGAACTATCGGATAACCCCAATTTATCGCCAGTCGGCTTAACAACGCTTGCTGGCCCAGAAGCCGGATT
GGTTTTCTCACGCATCAACGGTACACCGATTACCCTTAATATAGCGGGGATGTTTACTCCGGCGGGGTAT
CAAATGGGGATAGGTAACAATCTCACTACCCTCATCGATAAGTTATACAGTCAAAATGCATGGATACTGG
GCCAGTATGCAGAAATATCAACCCCAAGAGAGCTTACCCTCTTAGTACGACAATTTTATCTCCATGATTA
TCTTGAACAATGGGATAAATTTCTGTTCGACATCCGTCTAAACAATATTGACAGCCTGGAGCAGCGTTCT
AATATAGCCCAGTTTCTGGCTTCAAATGCTTCTCCCATGCGCAATCTGCTCATTAATATCAGTAAGAATG
TCAATCTGGATGAAAGGTTAAGCGATAACCATTTTGATAAAAAAATCGGTGAGTTGGTCAGCCGTAAAGC
AGATTCATTGACAAAAGTCGTACCTAATCCATTCATGTCAGGAGATAACCTCCCCACCCCGGAACAAGAA
TTGAGAAAACATTTTGCCCAAATTACTGCATTGGCAAACAATCCAGACGGTAAAAATAAGCAAATTCCTT
TTGATCATGTTCTCAGTCAACTTGCCAAATTACACGAATATCTGGATTCAGTACAAAATGCTACCAATAT
AGGCATACCCGCGCCATCGGATGAAATTATCACCCAACTCCAAGCCACGGCGGAGCGGTTGCCGATCCCA
TTCAAGGGCATCATTTCCTCGTTGGCAATGGGGGCTAACAGTGATACACAAGCCAGTAACGTAAAGAATC
TCAATAAGCAGCTGAATACAGAAGTCCAAGGCTTTTGTCATCAAGCGATTGCCAACCGCTATCCGCTGAC
GCCGTGGGCACTTGATGATATCAGACCGGATGATATGGCTCGGATGTTTGCGCCACAAACGGGGATCATG
GATAGCTTTTTCCAAAAAAATCTGGTGGGAAAAGTCGATACATCTCACGAAAACTGGCGCCTTATACTGG
GAACGGATAGCAAAGCAAAAGCATTACCGGAAAGTCACAAGTTACTCCTGCCATTCCAACAAGCCCAGAT
CATTCGAGATACTTTATTCAGCGACGGCTCGCGTATCCCTTCATTTCGGGTCATCGTCCGCACCGTAAAT
ATGGATAAAGAGATATTGAGTATGATACTGGATGTTGATGGTCAGCAATTGCAATATAGCCACGGCCCAC
AAGTTTCGCAGTCACTCAATTGGCCTGGCCCAAACGGCTCCAATCAGGCTCGTATCCAATTAAATTTAGA
TGATGGGACAACAGCGAGTCTCATCACTTCCGGCCCGTGGGCATTAAATCGCTTAATTGACCATGAACAA
TTCGCGGCAGGAAAACCCGCCACAAATAATCATACAAGCCAGCGTGTGACATTTAATATCAGAGGCCATC
ATGTCTCATTGGAATTTATTCCAAACAGTATTCTCAGCCCGTTTCAACTTCCCATTTTCGTCTGTCCCAA
GCTGATTAATTCATAA
 Primer design