SecReT6
Protein ID: 291281039
SecReT6 ID383
T6SS typei1
Gene symbol-
Locus tagG2583_0227
StrainEscherichia coli O55:H7 str. CB9615
Repliconchromosome [GenBank: NC_013941] [Browse all T6SS(s) in this replicon]
Location [Strand]245357..248821 [-]
Productmacrophage toxin
NoteTssM
UniProt IDD3QWL7
KEGG IDeok:G2583_0227
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 5.50E-85, Aligned region: 303..344
IcmF-related [PF06761], Evalue: 5.50E-85, Aligned region: 485..798
ImcF-related_N [PF14331], Evalue: 2.40E-62, Aligned region: 185..435
DUF1215 [PF06744], Evalue: 1.10E-33, Aligned region: 284..302
DUF1215 [PF06744], Evalue: 1.10E-33, Aligned region: 894..1013
AAA_22 [PF13401], Evalue: 0.00014, Aligned region: 120..253
AAA_22 [PF13401], Evalue: 0.00014, Aligned region: 836..867
Protein Sequence: 1154 a.a.     [Download]
>gi|291281039|ref|YP_003497857.1| macrophage toxin [Escherichia coli O55:H7 str. CB9615]
MPRFKVSAFWLLILAWIFLLVWIWWKGPTWTLYEEQWLKPLANRWLATAAWGIIALVWLTVRVMKRLQLL
EKQQKQQREEAIDPLSVELNAQQRYLDRWLLRLQRHLDNRRFLWQLPWYMVIGPAGSGKTTLLREGFPSD
IIYAPEGARGTEQRLYLTPHVGKQAVIFDIDGTLCAPADADILHRRLWEHALGWLKEKRARQPLNGIILT
LDLPDLLTADKRHREHLLQTLRSRLQDIRQHLHCQLPVYVVLTRLDLLQGFAALFQSLNRQDRDAILGVT
FTRRAHENDDWRTELNAFWQTWVDRMNLALPDLMVTQTHTRASLFSFSRQMQGSREPLVSLLEGLLDGEN
MNVMLRGVYLTSSLQRGQMDDIFTQSAARQYRLGNNPLASWPLVDTAPYFTRSLFPQALLAEPNLATESR
AWLMRSRRRLTVFSATGGVAALLLITGWHHYYNGNYQSGITVLKQAKAFMDVPPPQGEDDYGNLQLPLLN
PVRDATLAYGDWGDRSRLADMGLYQGRRIGPYVEQTYLQLLEQRYLPSLFNGLVKAMNAAPPESEEKLAV
LRVMRMLEDKSGRNNEVVKQYMAKRWSEKFHGQRDIQAQLMSHLDYALAHTDWHAERQAGDGDAISRWTP
YDKPVVSAQKELSKLPVYQRVYQSLKTRALGVLPADLNLRDQVGPTFDQVFTSADDNKLVVPQFLTRYGL
QSYFVKQRDELVELTAMDSWVLNLTRSVKYSDADRAEIQRQLTEQYISDYTATWRAGMDNLNIRNFESIG
QLTGALEQVISGDQPLQRALTVLRDNTQPGVFSEKLSAKERDEALAEPDYQLLTRLGHEFAPENITLAVQ
KDKESTMQAVYQQLTELHRYLLAIQNAPVPGKSALKAVQLRLDQNSSDPIFATRQMAKTLPAPLNRWVGR
LTDQAWHVVMVEAVHYMEVDWRDSVVKPFNEQLANNYPFNPRSAQDASLDAFERFFKPDGILDTFYQQNL
KLFIDNDLSLEDGDNNVIIREDIIAQLETAQKIRDIFFSKQNGLGTSFAVETVSLSGNKRRSVLNLDGQL
VDYSQGRNYTAHLVWPNNMREGNESKLTLIGTSGNAPRSISFSGPWAQFRLFGAGQLTGVQDGNFTVRFS
VDGGAMTYRVHTDTEDNPFSGGLFSQFGLSDTLY
 
Nucleotide Sequence: 3465 bp     [Download]
>gi|291280824|ref|NC_013941.1|:c248821-245357 Escherichia coli O55:H7 str. CB9615 chromosome, complete genome
ATGCCCCGGTTTAAAGTCTCCGCTTTCTGGCTGCTGATACTGGCGTGGATTTTTCTGCTGGTATGGATCT
GGTGGAAAGGCCCGACGTGGACGCTGTATGAAGAACAGTGGCTCAAACCACTGGCGAACCGCTGGCTGGC
AACGGCGGCGTGGGGGATTATTGCCCTGGTGTGGCTTACCGTCCGGGTAATGAAGCGCCTGCAACTGCTT
GAAAAACAGCAAAAACAGCAGCGCGAAGAGGCCATTGATCCGCTCAGTGTGGAGCTGAACGCCCAGCAGC
GTTACCTTGACCGCTGGCTGCTGCGCCTGCAACGCCATCTCGACAACCGCCGTTTCCTGTGGCAGTTACC
GTGGTATATGGTCATCGGCCCGGCGGGCAGTGGCAAAACGACACTGCTGCGCGAGGGGTTTCCGTCAGAC
ATTATTTATGCCCCGGAGGGCGCGCGCGGCACAGAACAACGCCTGTACCTTACGCCCCATGTCGGTAAAC
AGGCGGTGATCTTTGATATCGACGGCACACTCTGCGCTCCCGCTGATGCGGATATCCTGCATCGCCGTCT
GTGGGAACATGCCCTCGGCTGGCTGAAAGAAAAGCGCGCGCGCCAGCCGCTGAACGGGATTATTCTGACA
CTCGATTTACCCGATCTGCTGACCGCAGACAAACGCCACCGCGAGCATCTGTTACAGACGCTGCGCAGCC
GCTTACAGGATATACGCCAGCATCTTCACTGCCAGTTACCGGTTTACGTGGTACTGACCCGGCTTGATTT
ATTACAGGGTTTTGCCGCCCTGTTCCAGTCCCTGAACAGACAGGATCGCGATGCGATTCTGGGCGTCACG
TTCACCCGCCGTGCCCATGAAAATGATGACTGGCGAACAGAGTTGAATGCTTTCTGGCAGACATGGGTGG
ATCGAATGAATCTGGCGTTGCCGGATCTGATGGTCACCCAGACTCACACCCGCGCGTCTTTATTCAGTTT
TTCCCGCCAGATGCAGGGAAGCCGTGAACCGCTGGTGTCACTGCTTGAGGGTCTGCTTGACGGTGAAAAT
ATGAACGTGATGCTGCGTGGTGTCTATCTCACCTCTTCGCTTCAGCGCGGGCAGATGGATGATATATTCA
CCCAGTCTGCCGCCCGCCAGTACCGACTGGGCAATAACCCACTGGCGTCCTGGCCTCTGGTGGACACCGC
GCCTTATTTCACCCGCAGCTTGTTCCCGCAGGCATTACTCGCAGAGCCTAATCTGGCAACGGAGAGCCGC
GCCTGGCTGATGCGTTCCCGTCGCCGCCTGACGGTTTTCTCTGCCACCGGCGGCGTGGCGGCACTGCTGC
TCATCACCGGCTGGCATCACTATTACAACGGTAACTATCAGTCCGGCATCACCGTGCTTAAGCAGGCCAA
AGCCTTTATGGATGTGCCGCCTCCACAGGGGGAAGATGACTACGGCAACCTGCAACTGCCGCTGCTGAAC
CCGGTACGCGATGCCACACTGGCCTATGGCGACTGGGGCGACCGCAGCCGTCTGGCCGATATGGGACTGT
ACCAGGGACGACGTATCGGACCTTATGTGGAACAGACCTATCTGCAACTGCTGGAGCAACGTTACCTGCC
CTCGCTGTTTAACGGGCTGGTTAAAGCGATGAATGCCGCGCCGCCGGAGAGTGAAGAAAAACTCGCGGTG
CTGCGCGTGATGCGAATGCTGGAGGACAAAAGCGGACGTAACAATGAGGTGGTGAAGCAGTATATGGCAA
AACGCTGGAGCGAAAAGTTCCACGGCCAGCGCGATATCCAGGCACAACTGATGTCCCATCTTGACTACGC
GCTGGCTCATACTGACTGGCACGCAGAGCGTCAGGCGGGCGACGGTGACGCCATCAGCCGCTGGACGCCA
TATGACAAGCCCGTGGTATCAGCACAGAAAGAACTGAGCAAACTGCCTGTCTACCAGCGGGTTTACCAGA
GCCTGAAAACGCGGGCGCTGGGCGTTCTTCCTGCCGACCTCAATCTGCGTGACCAGGTAGGGCCAACCTT
TGACCAGGTGTTTACATCTGCCGATGACAACAAACTGGTTGTTCCACAGTTTCTTACCCGTTACGGCCTG
CAAAGCTATTTTGTAAAACAGCGCGATGAACTGGTTGAACTGACGGCGATGGATTCCTGGGTACTTAACC
TTACCCGCAGCGTGAAATACAGTGACGCCGACCGCGCGGAAATCCAGCGCCAGCTCACCGAGCAGTATAT
CAGCGACTACACCGCCACCTGGCGGGCCGGGATGGACAATCTGAATATCCGCAATTTTGAGTCCATCGGA
CAACTGACCGGGGCGCTGGAGCAGGTTATCAGCGGCGACCAGCCTTTGCAGCGGGCGCTGACCGTGCTGC
GTGACAACACACAGCCAGGCGTCTTTTCTGAAAAACTCTCTGCCAAAGAACGGGATGAGGCCCTGGCAGA
GCCGGACTACCAGTTACTCACCCGTCTCGGGCATGAGTTCGCCCCGGAAAACATTACCCTGGCAGTACAG
AAAGACAAAGAAAGCACGATGCAGGCCGTGTATCAGCAACTCACCGAGTTGCACCGCTACCTGCTGGCAA
TCCAGAACGCGCCTGTACCAGGGAAATCGGCGCTGAAAGCCGTGCAGTTACGGCTTGATCAGAACAGCAG
CGATCCGATATTCGCCACCCGCCAGATGGCAAAAACGCTGCCTGCTCCGCTCAACCGCTGGGTTGGCAGA
CTGACTGACCAGGCCTGGCATGTGGTGATGGTGGAGGCTGTACATTATATGGAAGTGGACTGGCGCGACA
GCGTGGTGAAACCGTTTAACGAGCAACTGGCAAATAACTATCCGTTTAATCCGCGTTCTGCACAGGATGC
CTCACTGGATGCCTTCGAACGCTTCTTTAAACCGGATGGCATACTGGATACCTTCTACCAGCAGAACCTG
AAGCTGTTTATCGATAATGACCTGAGTCTGGAGGATGGCGATAACAACGTCATTATTCGCGAAGATATTA
TTGCGCAACTGGAAACTGCGCAGAAAATCCGTGACATCTTCTTCAGCAAACAGAACGGTCTGGGAACATC
CTTTGCCGTGGAAACGGTATCGCTTTCAGGCAATAAACGCCGCAGTGTACTGAACCTTGACGGTCAGTTA
GTCGATTACAGCCAGGGCCGTAACTATACCGCCCATCTGGTCTGGCCTAACAACATGCGCGAAGGCAACG
AAAGTAAGCTGACGCTCATCGGCACCAGCGGCAACGCGCCGCGCAGTATCAGCTTCAGCGGGCCGTGGGC
GCAGTTCCGCCTGTTCGGGGCCGGACAACTGACCGGAGTACAGGATGGCAACTTTACCGTGCGCTTTAGC
GTGGACGGTGGCGCGATGACCTACCGTGTGCATACCGACACGGAAGATAACCCGTTCAGCGGTGGGTTGT
TCAGCCAGTTTGGTCTGTCAGACACACTGTACTGA
 Primer design