SecReT6
Protein ID: 291617905
SecReT6 ID384
T6SS typei3
Gene symbol-
Locus tagPANA_2352
StrainPantoea ananatis LMG 20103
Repliconchromosome [GenBank: NC_013956] [Browse all T6SS(s) in this replicon]
Location [Strand]2617516..2620086 [-]
Producthypothetical Protein
NoteTssI
UniProt IDD4GHK2
KEGG IDpam:PANA_2352
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.00E-74, Aligned region: 25..332
Phage_GPD [PF05954], Evalue: 2.00E-74, Aligned region: 514..558
Phage_base_V [PF04717], Evalue: 3.70E-24, Aligned region: 370..463
Protein Sequence: 856 a.a.     [Download]
>gi|291617905|ref|YP_003520647.1| hypothetical Protein PANA_2352 [Pantoea ananatis LMG 20103]
MSMFSRITVQLPAQGLLFRRLSGSEALSQSFVLQAELLSTDARIDRKSLLGKPVTFTLPTDGLLSAVNPR
YINGKITQIGVRSEELGGVRYAVYGLTVESDLWPMKRDRNLRIFQSQTVPQIVQTLLKEYGVNVETRLAG
SYRVWEYCVQYQESSFDFISRLMELEGIYYFFRHEADKHTLVLCDAPDQHQAFPGYETIAYHVTPSGGSV
TEEGVSQWALSESVTPGMYSTDDYDFRKPNAWMLQARQNPVSPTPGSVDVYDWPGRFVEHGHGEYYARIR
QEVWQVEHHMVSGSGTATGIAPGYTFSLLNAPHFSDNGKYLVTSAHYDFEENSYASGDVGATRHNIDFTV
LPAAVTYRAKPETPWPKTHGPQTAKVVGPKGESIWTDKYGRVKVKFHWDRLAKGDDTSSCWVRVSSAWAG
QGFGGVQIPRVNDEVVVDFINGDPDRPLIIGRVYNEASMPPWALPAAATQMGFLSRSKDGTADTANALRF
EDKAGEEHLWIQAQKNMDTNVKNDETHSVGGERSHYVAKNELHRVEANQSQAVKGGTEILTGQGKVDAVV
EQYVLASGTQLRLVSGESAIELNANGTINLIGKDFNFFVENDGHITTGGKLNLNTSGAKPGTSAPGAGHK
GDIDAAVQEKFTPGKPDTAGALASAPADASNNVANPTRVQTSSFSGYGKDVDNLVEKSPTMKQDITTLKK
RGWVFKEGEAGKGTSADRQGRIITVDKSQMNNAAKVVQSLSHESGHALYKPNIDLSSKNSYLNSTLSDEG
AATLNNIRVQREIIANQGGDIGIAGNAANQKDYNSIFDSLQKGDITESDARMKIGRIFGKGEQTSTTKEF
YEDYYGGWYDKNYPSK
 
Nucleotide Sequence: 2571 bp     [Download]
>gi|332139403|ref|NC_013956.2|:c2620086-2617516 Pantoea ananatis LMG 20103 chromosome, complete genome
ATGTCTATGTTCTCACGTATTACTGTACAACTTCCCGCACAAGGACTGCTGTTCCGACGTCTGAGCGGCA
GCGAAGCGCTGTCCCAGTCGTTCGTGCTGCAAGCGGAGCTGCTCTCCACCGACGCGCGCATTGATCGTAA
GTCGTTGCTGGGCAAGCCGGTCACTTTCACGCTGCCGACGGATGGTCTGCTGAGCGCGGTGAATCCGCGC
TACATCAACGGCAAAATTACTCAGATAGGCGTGCGCAGCGAGGAGCTGGGCGGCGTGCGCTACGCCGTTT
ACGGGCTGACGGTGGAGTCGGATCTGTGGCCGATGAAGCGCGACCGCAACCTGCGCATCTTCCAGAGCCA
GACGGTGCCGCAGATTGTGCAGACGCTGCTGAAGGAGTACGGAGTGAACGTGGAAACGCGCCTGGCGGGA
AGCTACCGGGTGTGGGAATACTGCGTGCAGTATCAGGAGAGCAGCTTCGACTTTATCAGCCGGCTGATGG
AGCTGGAGGGGATTTACTACTTCTTCCGGCACGAGGCGGACAAGCACACGCTGGTGCTGTGCGACGCGCC
GGACCAGCATCAGGCGTTCCCGGGCTACGAAACGATAGCCTACCACGTGACGCCGTCGGGCGGCAGCGTG
ACGGAAGAGGGCGTGAGCCAGTGGGCGCTGTCGGAAAGCGTGACGCCGGGGATGTACAGCACGGACGACT
ACGACTTCCGCAAGCCGAACGCGTGGATGCTGCAGGCGCGGCAGAACCCGGTGTCGCCGACCCCGGGCTC
GGTGGACGTGTACGACTGGCCGGGTCGCTTCGTGGAGCACGGTCACGGCGAATACTACGCGCGTATCCGC
CAGGAGGTGTGGCAGGTCGAGCACCACATGGTGAGTGGGAGCGGCACGGCGACGGGCATCGCGCCGGGCT
ACACTTTTTCGCTGCTGAACGCGCCGCACTTCAGCGACAACGGCAAATACCTGGTGACGTCGGCGCACTA
CGACTTTGAAGAGAACAGCTACGCGAGCGGCGACGTGGGCGCCACGCGGCACAACATCGACTTCACGGTG
CTGCCGGCGGCGGTGACGTACCGTGCGAAGCCGGAGACGCCGTGGCCGAAGACGCACGGCCCGCAGACGG
CGAAGGTGGTGGGGCCGAAAGGCGAGAGCATCTGGACGGACAAATACGGCCGGGTGAAGGTGAAGTTCCA
CTGGGACCGTCTGGCGAAGGGCGACGACACGAGTTCGTGCTGGGTGCGCGTATCGAGTGCCTGGGCGGGT
CAGGGCTTCGGCGGGGTGCAGATCCCGCGCGTCAACGATGAGGTCGTCGTGGACTTCATCAACGGCGATC
CAGACCGTCCGTTGATCATTGGCCGCGTTTATAACGAAGCCAGTATGCCGCCATGGGCACTACCGGCTGC
CGCCACACAAATGGGCTTTCTGAGTCGCTCGAAAGACGGCACTGCGGATACCGCGAACGCATTACGCTTT
GAGGATAAGGCGGGCGAGGAACACTTGTGGATCCAGGCGCAGAAGAACATGGATACCAACGTCAAAAATG
ACGAAACGCACAGCGTTGGTGGAGAACGAAGCCACTATGTTGCTAAAAATGAGCTGCATAGGGTTGAAGC
GAATCAGAGTCAGGCTGTAAAAGGCGGAACCGAAATCCTGACTGGCCAGGGTAAAGTTGATGCCGTAGTT
GAACAGTATGTTCTGGCGTCGGGAACACAGTTGAGGCTTGTTTCTGGTGAAAGTGCTATCGAGCTCAATG
CCAACGGAACAATAAATCTTATCGGAAAAGATTTTAACTTCTTTGTTGAGAACGATGGACATATTACGAC
GGGTGGCAAACTGAATCTGAATACGTCGGGGGCTAAACCTGGCACAAGTGCGCCGGGTGCAGGCCACAAA
GGCGATATTGATGCGGCCGTACAGGAGAAATTTACGCCGGGAAAGCCTGATACGGCAGGTGCGCTGGCAA
GCGCACCTGCCGACGCTTCAAATAATGTGGCTAATCCCACGCGTGTTCAAACATCCTCTTTTAGCGGTTA
TGGCAAAGATGTCGATAATTTGGTTGAGAAATCACCTACCATGAAACAGGATATCACTACACTGAAAAAG
CGCGGATGGGTGTTTAAAGAAGGTGAGGCGGGCAAGGGGACTTCAGCGGATCGTCAGGGACGTATCATAA
CCGTCGATAAAAGCCAGATGAATAACGCCGCTAAAGTCGTCCAGTCGCTGTCACATGAGAGTGGGCATGC
ACTCTATAAACCCAATATTGATCTGAGTTCTAAGAATAGTTATCTGAACAGTACACTCAGTGATGAAGGC
GCTGCCACACTAAATAATATTCGTGTACAGCGTGAAATCATTGCTAATCAGGGGGGAGACATCGGTATAG
CCGGTAATGCTGCGAATCAGAAGGATTACAACAGTATCTTCGACTCCTTGCAAAAAGGTGACATAACTGA
GAGTGACGCAAGAATGAAAATTGGGCGCATCTTTGGAAAGGGTGAACAGACCTCCACCACTAAGGAGTTT
TACGAAGATTATTATGGAGGTTGGTATGATAAAAATTACCCGTCAAAGTAA
 Primer design