SecReT6
Protein ID: 291617907
SecReT6 ID384
T6SS typei3
Gene symbolclpV
Locus tagPANA_2354
StrainPantoea ananatis LMG 20103
Repliconchromosome [GenBank: NC_013956] [Browse all T6SS(s) in this replicon]
Location [Strand]2621585..2624194 [-]
ProductClpV
NoteTssH
UniProt IDD4GHK4
KEGG IDpam:PANA_2354
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.40E-40, Aligned region: 224..244
AAA_2 [PF07724], Evalue: 1.40E-40, Aligned region: 600..765
AAA [PF00004], Evalue: 3.90E-21, Aligned region: 123..155
AAA [PF00004], Evalue: 3.90E-21, Aligned region: 224..357
AAA [PF00004], Evalue: 3.90E-21, Aligned region: 373..392
AAA [PF00004], Evalue: 3.90E-21, Aligned region: 606..690
ClpB_D2-small [PF10431], Evalue: 4.50E-16, Aligned region: 773..848
AAA_5 [PF07728], Evalue: 1.30E-11, Aligned region: 224..250
AAA_5 [PF07728], Evalue: 1.30E-11, Aligned region: 605..723
AAA_16 [PF13191], Evalue: 1.20E-08, Aligned region: 34..78
AAA_16 [PF13191], Evalue: 1.20E-08, Aligned region: 201..245
AAA_16 [PF13191], Evalue: 1.20E-08, Aligned region: 269..303
AAA_16 [PF13191], Evalue: 1.20E-08, Aligned region: 599..650
AAA_16 [PF13191], Evalue: 1.20E-08, Aligned region: 670..693
AAA_22 [PF13401], Evalue: 1.80E-08, Aligned region: 224..305
AAA_22 [PF13401], Evalue: 1.80E-08, Aligned region: 363..390
AAA_22 [PF13401], Evalue: 1.80E-08, Aligned region: 604..629
AAA_22 [PF13401], Evalue: 1.80E-08, Aligned region: 667..691
Sigma54_activat [PF00158], Evalue: 4.60E-07, Aligned region: 210..238
Sigma54_activat [PF00158], Evalue: 4.60E-07, Aligned region: 295..305
Sigma54_activat [PF00158], Evalue: 4.60E-07, Aligned region: 605..721
AAA_14 [PF13173], Evalue: 1.30E-06, Aligned region: 225..304
AAA_14 [PF13173], Evalue: 1.30E-06, Aligned region: 330..390
AAA_14 [PF13173], Evalue: 1.30E-06, Aligned region: 604..715
AAA_25 [PF13481], Evalue: 4.30E-06, Aligned region: 223..248
AAA_25 [PF13481], Evalue: 4.30E-06, Aligned region: 277..321
AAA_25 [PF13481], Evalue: 4.30E-06, Aligned region: 478..500
AAA_25 [PF13481], Evalue: 4.30E-06, Aligned region: 595..630
AAA_25 [PF13481], Evalue: 4.30E-06, Aligned region: 779..809
AAA_19 [PF13245], Evalue: 1.50E-05, Aligned region: 173..215
AAA_19 [PF13245], Evalue: 1.50E-05, Aligned region: 223..248
AAA_19 [PF13245], Evalue: 1.50E-05, Aligned region: 603..627
AAA_17 [PF13207], Evalue: 1.80E-05, Aligned region: 224..266
AAA_17 [PF13207], Evalue: 1.80E-05, Aligned region: 605..641
IstB_IS21 [PF01695], Evalue: 2.10E-05, Aligned region: 209..243
IstB_IS21 [PF01695], Evalue: 2.10E-05, Aligned region: 470..496
IstB_IS21 [PF01695], Evalue: 2.10E-05, Aligned region: 605..626
IstB_IS21 [PF01695], Evalue: 2.10E-05, Aligned region: 715..736
Clp_N [PF02861], Evalue: 2.20E-05, Aligned region: 28..75
Clp_N [PF02861], Evalue: 2.20E-05, Aligned region: 116..132
Clp_N [PF02861], Evalue: 2.20E-05, Aligned region: 311..321
NACHT [PF05729], Evalue: 2.30E-05, Aligned region: 224..259
NACHT [PF05729], Evalue: 2.30E-05, Aligned region: 606..632
Zeta_toxin [PF06414], Evalue: 4.00E-05, Aligned region: 223..244
Zeta_toxin [PF06414], Evalue: 4.00E-05, Aligned region: 599..645
AAA_18 [PF13238], Evalue: 0.0001, Aligned region: 224..244
AAA_18 [PF13238], Evalue: 0.0001, Aligned region: 607..634
AAA_18 [PF13238], Evalue: 0.0001, Aligned region: 805..854
Arch_ATPase [PF01637], Evalue: 0.00056, Aligned region: 203..238
Arch_ATPase [PF01637], Evalue: 0.00056, Aligned region: 277..308
Arch_ATPase [PF01637], Evalue: 0.00056, Aligned region: 355..398
Arch_ATPase [PF01637], Evalue: 0.00056, Aligned region: 604..645
AAA_29 [PF13555], Evalue: 0.00076, Aligned region: 216..240
AAA_29 [PF13555], Evalue: 0.00076, Aligned region: 603..630
RNA_helicase [PF00910], Evalue: 0.0026, Aligned region: 225..245
RNA_helicase [PF00910], Evalue: 0.0026, Aligned region: 606..627
RNA_helicase [PF00910], Evalue: 0.0026, Aligned region: 703..724
FtsK_SpoIIIE [PF01580], Evalue: 0.0034, Aligned region: 216..267
FtsK_SpoIIIE [PF01580], Evalue: 0.0034, Aligned region: 594..627
SRP54 [PF00448], Evalue: 0.0073, Aligned region: 223..244
SRP54 [PF00448], Evalue: 0.0073, Aligned region: 604..637
RuvB_N [PF05496], Evalue: 0.0075, Aligned region: 222..241
RuvB_N [PF05496], Evalue: 0.0075, Aligned region: 279..304
RuvB_N [PF05496], Evalue: 0.0075, Aligned region: 574..626
RuvB_N [PF05496], Evalue: 0.0075, Aligned region: 674..698
T2SE [PF00437], Evalue: 0.0076, Aligned region: 207..241
T2SE [PF00437], Evalue: 0.0076, Aligned region: 602..682
Protein Sequence: 869 a.a.     [Download]
>gi|291617907|ref|YP_003520649.1| ClpV [Pantoea ananatis LMG 20103]
MSEISRAVLFGKLDTLLFTSLESATAFCKLRGNPYVELVHWLHQLMQQQDGDLQQVIKHFSLDENALTRD
IVAALDRLPRGAGAVSDLAEHIDSAVERAWVYASLKYGATRIRGGHLLIGMLKTFTLASVLKGISPQFSR
VNADALLEQFDTLLANSKEVQQALVQPAGDAAAPPAAGDSTLAQYAQDLTARARDGKIDPVAGRDEEIRQ
MVDILMRRRQNNPLLTGEAGVGKTAVVEGLALRIAAGDVPAPLRDVQLWLLDIGMLQAGAGMKGEFEARL
QALINEVQSSPTPIVLFIDEIHTLVGAGGQQGTGDAANLLKPALARGQLRTIGATTWAEYKKYIEKDPAL
TRRFQTVQVQEPDEAKAILMLRSTVSALEKHHQVLLLDEAVSAAVKLSHRYIPARQLPDKAVALLDTACA
RVAVSQGAQPAALEDCLHRLAALEIEAEIAEREVKVGLGDETRQATIAAQRAALEAERDALDARWQQERE
LVEQLIALRARCVTEGETSLREQLDETRQKLHAVQGEAPLLFAAVDASVVAAVVSDWTGIPLGRMVKNEI
DAVLNLADTLNQRVIGQRHGLDLIAKRVRTSRARLDNPNKPVGVFMLCGPSGVGKTETALALAESLYGGE
QNIITINMSEFQEAHTVSTLKGAPPGYVGYGEGGVLTEAVRRRPYSVVLLDEIEKAHPDVHELFFQVFDK
GWMEDGEGRHIDFRNTIIILTSNVGTQLISALCADPELMPDPDALSTALRKPLLEVFPPALLGRLLVVPY
YPLSDEMLAEIVKLQLGRIVRRLEENHGIEAIIDDSVVSQIVQRCTEVESGGRMVDAILTNTLLPQMSQI
LLSGHARDERYRRVQVSCDQGEFVCQFAV
 
Nucleotide Sequence: 2610 bp     [Download]
>gi|332139403|ref|NC_013956.2|:c2624194-2621585 Pantoea ananatis LMG 20103 chromosome, complete genome
ATGTCAGAGATCAGCCGTGCCGTGCTATTCGGCAAACTGGATACGCTGTTATTTACCTCGCTTGAGAGTG
CGACCGCCTTTTGTAAACTGCGTGGCAACCCCTATGTTGAACTGGTGCACTGGTTGCATCAGCTCATGCA
GCAGCAGGATGGCGATCTTCAGCAGGTGATTAAGCATTTTTCACTGGATGAAAACGCGCTGACGCGGGAT
ATCGTCGCTGCACTGGACCGCCTGCCGCGCGGTGCGGGTGCGGTGTCCGATCTCGCAGAACACATCGACA
GCGCCGTTGAGCGCGCCTGGGTTTATGCATCACTCAAATACGGTGCGACCCGTATTCGCGGTGGTCACCT
GCTGATAGGTATGCTGAAGACCTTTACGCTCGCCAGCGTCCTGAAAGGCATTTCACCCCAGTTTTCACGC
GTGAACGCCGATGCTTTACTGGAGCAGTTCGATACCTTGCTGGCGAACAGTAAAGAAGTTCAGCAGGCGC
TGGTTCAGCCCGCAGGCGATGCTGCCGCCCCTCCGGCGGCGGGCGACAGCACGTTAGCGCAGTATGCGCA
GGATCTGACCGCGCGAGCGCGCGACGGAAAAATCGACCCGGTTGCGGGCCGTGATGAAGAGATCCGCCAG
ATGGTGGATATCCTGATGCGCCGTCGCCAGAACAACCCGTTACTCACCGGTGAAGCTGGCGTGGGTAAAA
CGGCGGTGGTAGAAGGGCTGGCGCTGCGCATTGCCGCCGGTGATGTACCGGCACCGCTTCGTGACGTGCA
ACTGTGGCTGCTGGATATTGGCATGTTGCAGGCAGGCGCCGGCATGAAAGGCGAATTCGAAGCGCGTTTA
CAGGCCCTGATTAACGAAGTGCAATCCAGCCCTACGCCGATTGTGTTATTCATTGATGAAATTCATACCC
TGGTCGGTGCAGGCGGTCAGCAGGGCACAGGCGATGCCGCCAACCTGTTAAAGCCGGCCCTGGCGCGCGG
ACAGTTGCGCACGATTGGCGCAACGACCTGGGCGGAATACAAGAAATACATCGAAAAAGATCCTGCATTG
ACCCGCCGCTTCCAGACCGTTCAGGTGCAGGAGCCGGATGAAGCAAAAGCGATTCTGATGCTGCGCAGCA
CCGTGAGCGCGCTGGAAAAACACCATCAGGTGCTGTTACTGGATGAAGCCGTCAGCGCCGCCGTTAAGCT
CTCTCACCGTTACATTCCTGCCCGCCAGCTGCCGGATAAAGCCGTAGCCTTACTGGATACCGCCTGTGCA
CGCGTTGCCGTCAGCCAGGGCGCACAGCCTGCCGCGCTGGAAGACTGCCTGCACCGTCTGGCCGCGCTGG
AAATCGAAGCGGAGATCGCCGAACGTGAAGTCAAAGTGGGGCTGGGTGATGAAACCCGCCAGGCCACGAT
TGCCGCCCAGCGCGCTGCCCTGGAAGCAGAGCGCGATGCGCTGGACGCCCGCTGGCAGCAGGAGCGTGAG
CTGGTCGAACAGCTGATTGCCCTGCGCGCGCGTTGCGTGACCGAAGGCGAAACTTCCCTGCGCGAGCAGC
TCGATGAAACCCGACAGAAGTTGCATGCGGTTCAGGGTGAAGCCCCGTTACTGTTTGCTGCCGTTGACGC
CAGCGTCGTTGCCGCAGTGGTATCCGACTGGACCGGCATTCCGCTGGGCCGGATGGTGAAAAACGAAATT
GACGCCGTGCTTAACCTCGCGGACACGTTGAATCAGCGCGTAATTGGGCAGCGTCATGGGCTGGATCTGA
TTGCCAAACGCGTTCGCACCTCACGCGCCCGACTGGACAATCCCAATAAACCGGTCGGTGTGTTTATGCT
CTGTGGCCCGTCAGGCGTCGGGAAAACCGAAACCGCGCTGGCGCTGGCCGAATCGCTTTATGGTGGAGAG
CAAAACATCATCACCATCAACATGAGCGAGTTCCAGGAAGCGCACACCGTTTCAACGCTGAAAGGTGCCC
CTCCAGGCTATGTAGGTTACGGTGAAGGCGGTGTGCTGACGGAGGCCGTGCGTCGTCGTCCTTACAGCGT
CGTGCTGCTGGATGAGATTGAAAAAGCGCATCCTGATGTGCATGAGCTGTTTTTCCAGGTATTCGACAAA
GGCTGGATGGAAGATGGAGAAGGGCGCCACATTGATTTCCGCAATACCATTATCATCCTCACCTCTAACG
TCGGTACGCAACTGATCAGTGCGCTCTGTGCCGATCCGGAACTCATGCCGGATCCCGACGCGCTCAGCAC
CGCTTTACGTAAACCCTTACTGGAGGTGTTCCCGCCTGCACTGCTGGGCCGTCTGCTGGTGGTGCCTTAC
TATCCCCTCAGTGACGAGATGCTGGCAGAGATTGTTAAGCTGCAACTGGGGCGCATTGTTCGCCGTCTGG
AAGAGAACCACGGTATTGAAGCCATTATTGACGATTCGGTCGTCAGCCAGATCGTGCAGCGTTGTACGGA
AGTGGAGTCTGGAGGTCGCATGGTCGATGCCATCCTGACAAATACCCTGTTGCCGCAGATGAGCCAGATA
CTGCTCAGCGGCCATGCTCGTGATGAACGTTATCGTCGCGTGCAGGTCAGCTGTGATCAGGGCGAGTTTG
TTTGCCAGTTTGCTGTCTAA
 Primer design