SecReT6
Protein ID: 291617908
SecReT6 ID384
T6SS typei3
Gene symbol-
Locus tagPANA_2355
StrainPantoea ananatis LMG 20103
Repliconchromosome [GenBank: NC_013956] [Browse all T6SS(s) in this replicon]
Location [Strand]2624248..2625297 [-]
Producthypothetical Protein
NoteTssG
UniProt IDD4GHK5
KEGG IDpam:PANA_2355
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 9.80E-107, Aligned region: 26..330
Protein Sequence: 349 a.a.     [Download]
>gi|291617908|ref|YP_003520650.1| hypothetical Protein PANA_2355 [Pantoea ananatis LMG 20103]
MSETAHVIPLQRAVRLPDGFWQAVMAAPWRYDLFQLLRKLDAQSGQRYALGKAPLPKFEAVRLGQKPSLA
FAPSTVSQVKAREQDERYDVSIYSFGLFGPNGPLPTHLTEYVRGRIDHHQDHSLSAFADLFHHRATLLFY
RAWANSQPTSSLDRRDDRRFQDYLACVAGIGLPAQQKASSLSLHARLMLSGHLSRHGHDAEGLVRILRHY
FAVPVKLQQNVPQWLSLDSRDQARLSAGRHMPRLGESAFLGVAVRDVQHRFRLRIGPLSAEQYERFLPNA
QGACEVRDWVRHYLGIEMQWDLSLILAADAVKGVTLGGQARLGYTSWLGQQPQPVDREDFAFEVEATPS
 
Nucleotide Sequence: 1050 bp     [Download]
>gi|332139403|ref|NC_013956.2|:c2625297-2624248 Pantoea ananatis LMG 20103 chromosome, complete genome
ATGAGTGAGACGGCGCACGTTATTCCCCTACAGCGGGCGGTGCGTCTGCCTGACGGTTTCTGGCAGGCCG
TGATGGCCGCGCCCTGGCGCTATGATCTGTTTCAGCTGCTACGCAAGCTGGACGCCCAGAGTGGGCAGCG
GTATGCCTTAGGTAAAGCGCCACTGCCCAAATTTGAGGCCGTGCGTCTTGGGCAAAAGCCATCCCTGGCC
TTTGCACCGTCGACCGTGTCACAGGTTAAAGCGCGTGAGCAGGACGAACGCTACGACGTCTCCATTTACA
GCTTTGGGCTGTTTGGTCCCAACGGTCCTCTCCCTACGCACCTGACGGAATATGTACGGGGACGTATCGA
TCACCATCAGGATCACAGCCTGAGCGCTTTCGCCGATCTGTTTCATCATCGTGCCACGCTGCTGTTCTAC
CGTGCCTGGGCTAATTCACAGCCAACCAGCTCCCTGGATCGCCGCGACGATCGGCGGTTTCAGGATTATC
TGGCCTGCGTGGCCGGTATTGGGTTACCGGCCCAGCAGAAAGCCAGTTCGCTGAGTCTGCATGCGCGCCT
CATGCTGTCAGGGCATCTCAGCCGCCACGGTCACGATGCCGAAGGGCTGGTACGCATTTTGCGTCACTAC
TTTGCCGTTCCGGTTAAGCTGCAACAGAACGTGCCGCAGTGGTTATCCCTGGACAGCCGCGATCAGGCCC
GTCTGTCGGCCGGTCGCCATATGCCGCGCCTGGGTGAATCGGCCTTTCTCGGTGTGGCCGTTCGTGATGT
ACAGCATCGTTTTCGTCTGCGCATCGGTCCACTGAGCGCCGAGCAGTACGAACGTTTTTTACCCAACGCG
CAGGGCGCTTGCGAAGTGCGTGACTGGGTGCGCCACTATCTGGGTATTGAGATGCAGTGGGATCTCAGCC
TGATTCTGGCAGCCGATGCCGTTAAGGGCGTAACCCTTGGCGGTCAGGCGCGGCTGGGCTACACCAGTTG
GCTTGGACAGCAACCGCAGCCTGTCGATCGTGAAGATTTTGCCTTTGAGGTTGAAGCTACGCCGTCATAG
 Primer design