SecReT6
Protein ID: 291617909
SecReT6 ID384
T6SS typei3
Gene symbol-
Locus tagPANA_2356
StrainPantoea ananatis LMG 20103
Repliconchromosome [GenBank: NC_013956] [Browse all T6SS(s) in this replicon]
Location [Strand]2625294..2627171 [-]
Producthypothetical Protein
NoteTssF
UniProt IDD4GHK6
KEGG IDpam:PANA_2356
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.40E-211, Aligned region: 5..625
Protein Sequence: 625 a.a.     [Download]
>gi|291617909|ref|YP_003520651.1| hypothetical Protein PANA_2356 [Pantoea ananatis LMG 20103]
MDSKLLDYYNRELAYLREMGAEFAAQYPKVAGRLGMRGIDVADPYVERLMEGFAFLTSRVQLKMDAEFPR
FSQRMLEMVAPGYLSPTPSMAIAQLTPDSRKGDISNGFLVPRGTMMESQNLKKTGVTCSYTTAHDVMLQP
LRISDVSLGGVPADIPLGELKAGGSTAASSALRIRITCEGISSLSQLSLDDVMFFLSGPDIQALKLMELL
MQHRVGIILQSVEAKPQRQVLPDDALQQEGFSTEQALLPDDLRNFDGYRLLQEYFAFPARFQFISLRQLA
PFLQRCDNALSFDIVILLDKADAALESVVDSAHLALHCTPVINLFPKTAERLKVSDSQHEYHLVVDNIRP
LDYEIHSVKRLFASVEGQREEQIFRPFWSTFSHDGGDYGAYFSLRREQRTLSEHALRYGTRTGYIGSEVF
LSLVDQNHTPWNSDIRYLSAEVMCTSRDLPLMLLQQEQANFVMPDSIPVGQLKLCKGPTPPRPALAEGLS
AWRLISHLQMNYLSLMDSSDGEGAAALRQMLSLYASLAETPLTRQIDGIRHCNLKAVHRRVPEPGPVVFA
RGVSIALEVDEQAFSGASPWLFGSVLERVFSRLVALNSFTEFTLSSQQRGEVGYWPPRMGKKALL
 
Nucleotide Sequence: 1878 bp     [Download]
>gi|332139403|ref|NC_013956.2|:c2627171-2625294 Pantoea ananatis LMG 20103 chromosome, complete genome
ATGGACAGCAAGCTGCTTGATTACTACAACCGTGAACTGGCCTATCTGCGCGAGATGGGCGCGGAGTTTG
CTGCCCAGTATCCCAAGGTCGCCGGGCGGCTTGGTATGCGCGGCATTGACGTCGCCGATCCTTACGTCGA
AAGACTTATGGAGGGTTTCGCGTTTCTGACGTCACGCGTGCAGTTAAAGATGGATGCCGAGTTTCCACGC
TTTTCTCAGCGGATGCTGGAAATGGTGGCACCGGGCTACCTTTCACCTACGCCGTCGATGGCCATCGCCC
AGCTCACGCCGGACAGCCGCAAAGGCGATATCAGCAACGGTTTCTTAGTGCCGCGCGGCACAATGATGGA
AAGCCAGAACCTGAAAAAAACGGGCGTCACCTGCAGCTATACCACCGCGCACGATGTGATGTTACAGCCC
CTGCGTATCAGCGATGTGTCGTTAGGTGGCGTGCCAGCGGATATCCCGTTAGGCGAGTTGAAAGCGGGCG
GCTCGACGGCGGCGTCCAGCGCCCTCCGTATCCGCATCACCTGCGAAGGCATTTCATCGTTAAGCCAGCT
CAGTCTCGATGATGTGATGTTTTTCCTGAGCGGACCCGATATCCAGGCCCTGAAACTGATGGAGCTGCTG
ATGCAGCATCGTGTCGGAATCATCCTGCAGTCCGTGGAAGCAAAACCGCAACGTCAGGTTCTGCCGGATG
ACGCGCTTCAACAGGAAGGCTTTTCGACCGAGCAGGCCCTGCTGCCCGACGATCTGCGTAATTTTGACGG
CTACCGCCTGCTGCAGGAGTATTTTGCATTCCCGGCACGCTTCCAGTTTATCAGCCTGCGTCAGCTGGCG
CCTTTCCTGCAGCGCTGCGATAACGCCCTGTCGTTTGATATCGTCATCCTGCTGGATAAGGCCGATGCGG
CGCTGGAAAGCGTTGTCGACAGCGCCCATCTGGCCCTGCACTGCACACCGGTCATTAACCTGTTCCCGAA
AACCGCCGAGCGGCTTAAGGTCAGTGACAGTCAGCACGAGTATCACCTGGTGGTCGATAACATTCGTCCG
CTGGACTATGAGATCCATTCGGTGAAGCGCTTGTTCGCCTCTGTCGAAGGGCAGCGCGAAGAGCAGATCT
TCCGGCCGTTCTGGAGCACCTTCAGCCATGACGGCGGGGATTATGGCGCGTATTTCTCCCTGCGTCGTGA
ACAGCGCACGCTCTCTGAGCACGCGTTGCGCTATGGCACCCGAACGGGCTATATCGGTTCTGAAGTGTTT
CTCTCCCTGGTGGATCAAAATCATACTCCGTGGAACAGCGATATCCGCTATTTGTCTGCGGAAGTGATGT
GCACCAGCCGTGACTTGCCTTTGATGCTGCTACAGCAAGAGCAGGCCAACTTTGTGATGCCGGATTCCAT
TCCTGTCGGGCAACTTAAATTGTGCAAAGGCCCGACCCCACCGCGTCCGGCGCTGGCTGAAGGGCTTTCA
GCATGGCGACTCATCAGTCATCTGCAGATGAACTATCTGAGCCTGATGGACAGCAGCGATGGCGAAGGGG
CTGCGGCACTGCGCCAGATGCTGAGCCTGTATGCCAGCCTGGCTGAAACGCCGCTAACGCGTCAGATTGA
CGGAATTCGGCACTGCAACCTCAAAGCCGTTCACCGCCGGGTGCCCGAGCCGGGCCCCGTGGTGTTTGCG
CGCGGGGTCAGCATTGCGCTTGAGGTGGATGAGCAGGCGTTTTCAGGTGCCAGCCCCTGGCTGTTCGGCA
GCGTGCTGGAGCGGGTCTTTTCTCGCCTTGTGGCGCTTAACAGCTTTACCGAATTCACCCTGAGCAGCCA
GCAGCGCGGCGAAGTGGGCTACTGGCCGCCGCGCATGGGCAAAAAGGCGCTGCTATGA
 Primer design