SecReT6
Protein ID: 291617910
SecReT6 ID384
T6SS typei3
Gene symbol-
Locus tagPANA_2357
StrainPantoea ananatis LMG 20103
Repliconchromosome [GenBank: NC_013956] [Browse all T6SS(s) in this replicon]
Location [Strand]2627174..2627749 [-]
Producthypothetical Protein
NoteTssE
UniProt IDD4GHK7
KEGG IDpam:PANA_2357
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.20E-19, Aligned region: 60..170
Protein Sequence: 191 a.a.     [Download]
>gi|291617910|ref|YP_003520652.1| hypothetical Protein PANA_2357 [Pantoea ananatis LMG 20103]
MSRNDNSSGDGYSQLHGGYRARKNRDTLTARDKLQSSLLDRLTDDAPDKTTESGNSSIITHSTLRRNVLR
DLQWLFNTINNEAQHDLSDLTEVQRSVLNFGVAPLAGQNISDIEWQDMQRKMTDAILHFEPRILPQGLQV
RCVSDLTSLSLHNVLSIEIKGRLWCVPYPLEFLFRTQVDLESGHFELQDAG
 
Nucleotide Sequence: 576 bp     [Download]
>gi|332139403|ref|NC_013956.2|:c2627749-2627174 Pantoea ananatis LMG 20103 chromosome, complete genome
ATGAGTCGTAATGACAATTCGTCCGGTGACGGCTATTCGCAGCTGCATGGCGGCTATCGTGCGCGCAAAA
ATCGCGACACGCTGACGGCGCGTGACAAACTGCAGTCGTCCCTGCTGGACAGGCTGACAGACGACGCGCC
AGATAAAACCACCGAGTCAGGCAACAGTTCGATTATTACCCACAGTACGCTGCGACGTAATGTTCTGCGC
GATCTCCAGTGGTTATTCAACACCATCAATAACGAGGCGCAGCACGATCTGAGCGACCTGACGGAGGTCC
AGCGTTCCGTGCTGAATTTTGGCGTGGCCCCCCTGGCCGGACAGAATATCTCGGACATCGAGTGGCAGGA
TATGCAACGGAAAATGACCGATGCCATTCTGCACTTTGAGCCACGCATTTTACCCCAGGGCTTACAGGTT
CGCTGCGTAAGCGACCTGACCTCTCTGAGTCTGCACAACGTACTATCGATTGAGATTAAAGGCCGGTTAT
GGTGCGTGCCGTACCCGCTGGAGTTTCTGTTCCGCACTCAGGTTGATTTAGAGAGCGGCCATTTTGAACT
ACAGGATGCAGGTTAA
 Primer design