SecReT6
Protein ID: 291617911
SecReT6 ID384
T6SS typei3
Gene symbol-
Locus tagPANA_2358
StrainPantoea ananatis LMG 20103
Repliconchromosome [GenBank: NC_013956] [Browse all T6SS(s) in this replicon]
Location [Strand]2627739..2628566 [-]
Producthypothetical Protein
NoteTagJ
UniProt IDD4GHK8
KEGG IDpam:PANA_2358
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 3.90E-41, Aligned region: 144..265
Protein Sequence: 275 a.a.     [Download]
>gi|291617911|ref|YP_003520653.1| hypothetical Protein PANA_2358 [Pantoea ananatis LMG 20103]
MDSLQQRLANATLAENLSSITAQIQANPADADLRAAFVQLLCLDGNWSRAQTQLKSWLAMLPQAQPTVTL
LQQAIEGEQKRAAVLRGEAEPQLPGSAWPWCQVLLAALKADIAGDKAVGAALRAQALESAEASAGTATTQ
EGESPFAWIMDGDSRFGPVCEAIANGHYYWIPFAAISEIEFQAPASVTDLVWRHTRLQLVDGSEQICQIP
VRYPLQDKADERFLRASVTEWQESGSDDGQFIGHGQKMWLSDEADYPLLTLQQLIFNETELPHES
 
Nucleotide Sequence: 828 bp     [Download]
>gi|332139403|ref|NC_013956.2|:c2628566-2627739 Pantoea ananatis LMG 20103 chromosome, complete genome
ATGGACTCATTACAACAGCGACTGGCCAATGCTACCCTGGCGGAAAACCTGTCCAGCATCACTGCACAAA
TCCAGGCGAATCCGGCTGATGCGGATTTACGGGCGGCATTTGTGCAACTCCTGTGCCTTGACGGTAACTG
GAGCAGGGCGCAGACACAGCTGAAATCCTGGCTGGCCATGCTGCCTCAGGCGCAGCCCACCGTGACCTTG
CTGCAACAGGCTATTGAGGGCGAACAGAAACGTGCAGCGGTTTTGCGCGGTGAAGCCGAGCCGCAACTGC
CAGGAAGCGCCTGGCCGTGGTGCCAGGTCTTACTGGCCGCGCTGAAAGCGGACATAGCGGGCGATAAGGC
CGTCGGTGCGGCACTGCGTGCTCAGGCGCTGGAAAGCGCAGAGGCGAGCGCCGGTACGGCCACAACCCAG
GAGGGGGAAAGCCCGTTCGCCTGGATAATGGACGGTGACAGCCGCTTCGGACCGGTCTGTGAAGCCATCG
CCAATGGACACTATTACTGGATCCCGTTTGCTGCCATCAGCGAAATAGAGTTTCAGGCTCCGGCAAGCGT
CACGGATCTGGTCTGGCGCCATACTCGCCTGCAGCTGGTGGACGGAAGTGAGCAAATTTGTCAGATTCCG
GTGCGCTACCCGCTTCAGGACAAGGCTGATGAACGCTTCCTGCGGGCAAGCGTAACGGAGTGGCAGGAAT
CAGGCAGCGATGACGGTCAGTTTATCGGTCACGGGCAAAAGATGTGGCTCAGCGATGAAGCAGATTATCC
CTTACTGACGCTGCAGCAGCTTATTTTCAACGAAACTGAGTTACCTCATGAGTCGTAA
 Primer design