SecReT6
Protein ID: 291617914
SecReT6 ID384
T6SS typei3
Gene symbol-
Locus tagPANA_2361
StrainPantoea ananatis LMG 20103
Repliconchromosome [GenBank: NC_013956] [Browse all T6SS(s) in this replicon]
Location [Strand]2630395..2632293 [-]
Producthypothetical Protein
NoteFha
UniProt IDD4GHL1
KEGG IDpam:PANA_2361
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 1.80E-07, Aligned region: 28..94
UreE_N [PF02814], Evalue: 0.0013, Aligned region: 33..50
UreE_N [PF02814], Evalue: 0.0013, Aligned region: 79..100
Protein Sequence: 632 a.a.     [Download]
>gi|291617914|ref|YP_003520656.1| hypothetical Protein PANA_2361 [Pantoea ananatis LMG 20103]
MMRFTIITAKPGHEPPQISFDFLPPGGTIGRGVDNNLILPDDDRTISRLQAIVHITAEGECRLTNRGNVT
RVLLNDIPLERGRQVELQDGDILGIDDYRLLVNDLNGEQQSQQPPLTAAAAPKQQPVPNAVPVQAPAAST
AAIPSEIWDSLAKEFSISDDLSKRKSAAPEMPEANPLTSTAANRNPEDPLAQLMSDKPLDIGQQPKTSSL
FDEEDALFAQESIFDDRTPSTLSAKQNAQGQPKIEETSTDVDPLNLFGSQATPDPRHHDDPLGLMMSGAV
PLAQPDMPVSQPMAAPSQPKENHQSAPLQQKEPHQAAPLQQKPHHQPMPDILDTAPVELADLSSSPLFDH
TETQVTHDPAFDPQPQPAQPEGAQSPIDYGGITLPTPQAVQRTPSPTPKGRLRIDPVASHNNSGGTEQSG
NASSGDALKGELLDALLEGMGLQDLQPTPQFDREQMRQFGQMLSMFSQGTVALLSSRSILKRGVKADMTV
ILDDANNPFKLLPSGKTVLMQMFGSRMPGFMPPRQAVRDALIDLQAHQLGMIAGIRAIIASMLQSFNPDQ
LEEEARQNGSVSRIGLPGSRKAALWEHFIQRYGETAGEIEDDFHTLFGEAFLHAYDMEVNQYKDSQTHTD
DA
 
Nucleotide Sequence: 1899 bp     [Download]
>gi|332139403|ref|NC_013956.2|:c2632293-2630395 Pantoea ananatis LMG 20103 chromosome, complete genome
GTGATGCGCTTTACGATAATAACCGCTAAACCCGGCCATGAACCGCCGCAAATCAGTTTCGATTTTCTTC
CTCCAGGCGGCACTATTGGTCGAGGCGTGGATAATAATCTGATATTGCCCGACGACGATCGCACTATTTC
TCGCCTGCAGGCTATCGTGCATATTACTGCAGAGGGCGAATGTCGCCTGACCAACCGCGGTAACGTTACG
CGCGTGCTGCTGAATGACATCCCGCTTGAGCGTGGACGTCAGGTGGAGTTGCAGGACGGAGATATTCTCG
GCATCGACGACTATCGCCTGCTGGTTAACGATCTTAATGGCGAGCAGCAATCGCAGCAGCCTCCGTTGAC
CGCTGCAGCCGCACCTAAGCAGCAGCCCGTACCCAATGCGGTCCCTGTACAGGCGCCGGCTGCCAGCACG
GCTGCCATTCCCAGCGAGATCTGGGACAGCCTTGCCAAAGAGTTTTCAATTTCTGATGACTTATCGAAAC
GTAAAAGTGCTGCGCCAGAAATGCCGGAGGCAAATCCGTTAACCTCTACAGCGGCAAACCGTAATCCCGA
AGATCCGCTGGCTCAGTTAATGAGCGATAAACCGCTGGATATCGGTCAGCAACCTAAGACAAGCAGCCTG
TTTGATGAAGAGGATGCGCTGTTTGCTCAGGAAAGCATTTTTGATGACCGCACGCCCAGCACCTTGTCGG
CAAAACAAAATGCGCAAGGGCAGCCCAAAATAGAGGAAACCTCCACGGACGTGGACCCGTTAAATCTGTT
TGGCAGCCAGGCCACGCCGGACCCGCGTCATCATGACGATCCGCTGGGGTTAATGATGAGCGGTGCAGTG
CCGCTGGCTCAGCCAGATATGCCGGTTTCGCAACCTATGGCTGCGCCATCGCAGCCGAAAGAAAACCATC
AGTCTGCACCCTTACAGCAGAAAGAGCCCCATCAAGCGGCGCCATTACAGCAGAAACCTCATCACCAGCC
GATGCCTGATATCCTGGATACTGCACCGGTTGAGTTGGCTGATTTAAGCAGTTCACCGCTGTTTGATCAC
ACGGAAACGCAGGTCACTCACGATCCCGCTTTCGATCCTCAACCGCAGCCTGCCCAGCCTGAAGGAGCGC
AAAGCCCGATTGATTACGGCGGCATTACCTTGCCAACACCGCAGGCGGTGCAACGCACGCCTTCGCCCAC
GCCAAAAGGGCGGCTGCGCATCGATCCGGTTGCCTCGCACAATAACAGCGGTGGGACCGAGCAGAGTGGC
AACGCCAGTAGCGGTGATGCCTTAAAGGGCGAGTTGCTGGATGCACTGCTGGAAGGTATGGGCCTGCAGG
ATCTGCAACCGACACCGCAGTTCGATCGTGAGCAGATGCGGCAGTTCGGCCAGATGCTCAGCATGTTCTC
GCAGGGAACGGTGGCACTGCTGTCTTCCCGGTCGATTTTAAAACGCGGTGTAAAAGCCGACATGACCGTG
ATCCTGGATGATGCTAACAACCCGTTTAAGCTCCTGCCGTCGGGTAAAACCGTATTGATGCAGATGTTTG
GCAGCCGTATGCCAGGTTTTATGCCGCCACGCCAGGCCGTGCGTGACGCTCTGATTGACCTCCAGGCGCA
CCAGTTAGGCATGATTGCCGGGATTCGCGCCATTATTGCTTCCATGCTGCAGTCCTTTAACCCCGATCAG
CTCGAAGAAGAAGCGCGTCAAAACGGTTCCGTATCGCGCATTGGACTACCCGGCAGCCGTAAAGCCGCGC
TGTGGGAGCATTTTATCCAGCGCTATGGCGAAACTGCCGGTGAAATTGAAGATGACTTCCATACCTTGTT
TGGCGAAGCCTTCTTGCACGCGTACGACATGGAAGTAAATCAGTATAAAGACTCACAAACCCACACGGAT
GACGCATGA
 Primer design