SecReT6
Protein ID: 291617918
SecReT6 ID384
T6SS typei3
Gene symbol-
Locus tagPANA_2365
StrainPantoea ananatis LMG 20103
Repliconchromosome [GenBank: NC_013956] [Browse all T6SS(s) in this replicon]
Location [Strand]2635382..2636881 [-]
Producthypothetical Protein
NoteTssC
UniProt IDD4GHL5
KEGG IDpam:PANA_2365
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.10E-198, Aligned region: 66..492
Protein Sequence: 499 a.a.     [Download]
>gi|291617918|ref|YP_003520660.1| hypothetical Protein PANA_2365 [Pantoea ananatis LMG 20103]
MNQTSQQPQSQGGASFSQDEFSALLNKEFRPKSDQAREAVESAVKTLAQQALENTVTMSSDAYRTIQALI
AEIDEKLSQQVNQIIHHEEFQKLESAWRGLSYLVNNTETDEMLKIRFMSISKQELSRTLKRYKGVGWDQS
PLFKKIYEQEYGQFGGEPFGCLVGDYYFDHSPQDVELLGEMARIGAAAHCPFITGTAPSVMQMESWQELA
NPRDLTKIFQNTEYAAWRSLRESEDARYLGLVMPRFLSRLPYGIRTNPVDSFDFEEQTDGSDHSNYSWTN
AAYAMAANINRSFKEYGWCTSIRGVESGGAVEDLPCHTFPSDDGGVDMKCPTEIAISDRREAELAKNGFM
PLVHRKNSDFAAFIGAQSLQKPAEYHDADATANARLAARLPYLFACCRFAHYLKCIVRDKIGSFRERDEM
ERWLNDWVMNYVDGDPANSSQETKSRKPLAAAEVNVEEQEDNPGYYAAKFFLRPHYQLEGLTVSLRLVSK
LPSLKSNEN
 
Nucleotide Sequence: 1500 bp     [Download]
>gi|332139403|ref|NC_013956.2|:c2636881-2635382 Pantoea ananatis LMG 20103 chromosome, complete genome
ATGAACCAGACTTCTCAACAACCACAATCGCAGGGCGGTGCCAGCTTTAGTCAGGATGAGTTCAGCGCGT
TACTGAATAAAGAATTTCGTCCTAAAAGCGACCAGGCACGCGAAGCTGTAGAAAGCGCGGTAAAAACCCT
GGCGCAGCAGGCGCTGGAAAACACCGTGACCATGTCCAGCGATGCCTACCGCACCATTCAGGCACTGATC
GCTGAGATTGACGAAAAGCTGTCTCAGCAGGTTAACCAGATTATTCATCACGAAGAGTTTCAGAAGCTGG
AAAGCGCCTGGCGTGGTCTGAGCTATCTGGTGAATAACACCGAAACTGATGAGATGCTCAAGATTCGCTT
TATGAGCATCTCCAAGCAGGAGCTGAGCCGCACCCTGAAACGCTATAAAGGCGTGGGCTGGGATCAGAGC
CCGCTGTTCAAGAAAATCTACGAACAGGAATATGGCCAGTTTGGTGGTGAACCTTTTGGCTGCCTGGTGG
GCGACTACTATTTCGATCACAGCCCGCAGGACGTCGAGCTGCTGGGCGAAATGGCGCGTATCGGTGCTGC
AGCACACTGTCCGTTTATCACCGGGACAGCCCCAAGCGTAATGCAGATGGAATCCTGGCAGGAACTGGCG
AATCCACGCGATCTGACCAAAATCTTCCAGAATACCGAATATGCTGCCTGGCGCAGCCTGCGCGAGTCTG
AGGACGCCCGCTATCTGGGCCTGGTGATGCCGCGCTTCCTTTCTCGTCTGCCTTACGGTATTCGCACCAA
CCCCGTGGACAGCTTTGATTTTGAAGAGCAGACCGACGGTTCCGACCACAGCAACTACAGCTGGACCAAC
GCGGCTTATGCCATGGCGGCCAACATCAACCGTTCGTTCAAAGAATACGGCTGGTGTACATCCATTCGCG
GCGTGGAGTCGGGTGGGGCGGTTGAAGATCTGCCTTGCCACACGTTCCCAAGCGATGACGGCGGCGTAGA
CATGAAATGCCCAACGGAAATCGCCATCAGCGATCGCCGCGAAGCCGAGCTCGCGAAGAATGGCTTTATG
CCGTTAGTTCACCGCAAAAACTCTGACTTTGCCGCCTTTATCGGCGCCCAGTCGCTGCAAAAGCCTGCGG
AGTACCACGATGCTGACGCCACCGCCAATGCGCGTCTGGCAGCGCGGCTGCCTTATCTGTTCGCCTGCTG
CCGTTTCGCTCACTATCTGAAGTGTATTGTGCGCGACAAGATTGGTTCGTTCCGCGAGCGCGACGAAATG
GAGCGCTGGCTGAATGACTGGGTGATGAACTATGTCGATGGTGACCCGGCTAACTCTTCTCAGGAAACCA
AATCACGCAAGCCACTGGCTGCGGCTGAGGTGAATGTGGAAGAGCAGGAAGACAACCCAGGTTATTACGC
CGCGAAATTCTTCCTGCGTCCGCATTACCAGCTGGAAGGGTTAACCGTTTCGCTGCGTCTGGTATCGAAA
CTGCCTTCGCTGAAGTCGAACGAAAACTAA
 Primer design